Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00585 (656 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 in... 33 0.85 sp|Q9K974|RECN_BACHD DNA repair protein recN (Recombination... 32 1.9 sp|Q97WH0|RAD50_SULSO DNA double-strand break repair rad50 ... 31 2.5 sp|O67247|YB87_AQUAE Hypothetical protein AQ_1187 31 3.2 sp|P21249|ANT1_ONCVO Major antigen (Myosin-like antigen) 30 4.2 sp|P36420|SYV_LACCA Valyl-tRNA synthetase (Valine--tRNA lig... 30 5.5 sp|Q8K999|Y450_BUCAP Hypothetical transport protein BUsg450 30 5.5
>sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 intein; Mja pol-2 intein] Length = 1634 Score = 32.7 bits (73), Expect = 0.85 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 315 EILDLVKDLLKLESDPAKLQRISKLLNDLNSKGYSFEKLRKK 440 +I + + DL++ D K IS++L N K +SF+K+ KK Sbjct: 902 KIGEYIDDLMRKHKDKIKFSGISEILETKNLKTFSFDKITKK 943
>sp|Q9K974|RECN_BACHD DNA repair protein recN (Recombination protein N) Length = 565 Score = 31.6 bits (70), Expect = 1.9 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 306 LLNEILDLVKDLL-KLESDPAKLQRISKLLNDLNSKGYSFEKLRKKYFKDVD 458 LL E + ++D L KLE DP +L+ I L++L +KL++KY VD Sbjct: 277 LLEEAMFTLRDYLDKLEFDPTRLEMIESRLHEL-------QKLKRKYGDSVD 321
>sp|Q97WH0|RAD50_SULSO DNA double-strand break repair rad50 ATPase Length = 864 Score = 31.2 bits (69), Expect = 2.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = +3 Query: 252 LDTLEKTIPLNIFSTVKSLLNEILDLVKDLLKLESDPAKLQRISKLLNDLNSKGYSFEKL 431 LD +E+ N TV+ +L+L KD KLE + ++ + K + D+ + +EK Sbjct: 178 LDRIEQDYN-NFKKTVEEKRARVLELKKDKEKLEDE---IKNLEKRIKDIKDQFDEYEKK 233 Query: 432 RKKYFK 449 R +Y K Sbjct: 234 RNQYLK 239
>sp|O67247|YB87_AQUAE Hypothetical protein AQ_1187 Length = 167 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/43 (32%), Positives = 28/43 (65%) Frame = +3 Query: 315 EILDLVKDLLKLESDPAKLQRISKLLNDLNSKGYSFEKLRKKY 443 +++++ ++LLK+E K Q SK+++ LN+ GY ++ KY Sbjct: 25 KLVNIYRELLKVEETLKKGQINSKVIDKLNALGYPIYQIYSKY 67
>sp|P21249|ANT1_ONCVO Major antigen (Myosin-like antigen) Length = 2022 Score = 30.4 bits (67), Expect = 4.2 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +3 Query: 231 TNIVGGLLDTL--EKTIPLNIFSTVKSLLNEILDLVKDLLKLESDPAKLQRISKLLNDLN 404 TN + L T+ ++TI I + LNE L DL L+ A+++ K++ND Sbjct: 1676 TNRLNSLEKTVSQQRTIETEIRQQLSLALNERNTLQNDLRDLQRRLARMETEKKIMND-- 1733 Query: 405 SKGYSFEKLRKKYFKDVDL 461 K EK+R K ++L Sbjct: 1734 -KYDELEKIRASLIKRIEL 1751
>sp|P36420|SYV_LACCA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) Length = 901 Score = 30.0 bits (66), Expect = 5.5 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +3 Query: 291 STVKSLLNEILDLVKDLLKLESDPAKL-QRISKLLNDLNSKGY 416 +T+ LNE++DL ++ KL D KL Q I+++ LN++G+ Sbjct: 823 ATIFVPLNELIDLDEEKAKLTKDAKKLEQEIARIDKKLNNQGF 865
>sp|Q8K999|Y450_BUCAP Hypothetical transport protein BUsg450 Length = 391 Score = 30.0 bits (66), Expect = 5.5 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -1 Query: 542 YHKRIIFNESHLIVIIIHINFSFY--NCFEIDIFEIFLSQFLKTVS 411 Y I+F+ L +I+ + F F+ N EI IF IFLS L +S Sbjct: 253 YFATIVFSFFFLFLIVFYFKFHFFLKNIIEICIFFIFLSLLLFLLS 298
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,143,060 Number of Sequences: 369166 Number of extensions: 757548 Number of successful extensions: 2491 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2487 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5462583840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)