Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_016_J10 (262 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidy... 29 3.8 sp|O75665|OFD1_HUMAN Oral-facial-digital syndrome 1 protein... 28 8.4
>sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 365 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 141 LLDTLEKTIPLNIFSTVKSLLNEILDLVK 227 LLD L ++PL I+ST S+L+ +DL++ Sbjct: 135 LLDRLLSSVPLEIYSTPVSVLSSQIDLLR 163
>sp|O75665|OFD1_HUMAN Oral-facial-digital syndrome 1 protein (Protein 71-7A) Length = 1012 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 202 NRLFTVENILSGIVFSRVSKRPPTIFVSGNPDSNL 98 N F EN+L+ +V SR++ P +PDS+L Sbjct: 591 NNPFKQENVLARMVASRITNYPTAWVEGSSPDSDL 625
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,386,775 Number of Sequences: 369166 Number of extensions: 337608 Number of successful extensions: 1069 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1068 length of database: 68,354,980 effective HSP length: 57 effective length of database: 57,825,085 effective search space used: 1676927465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)