Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_020_H03 (186 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O51035|Y001_BORBU Hypothetical protein BB0001 28 4.9 sp|Q89B25|Y030_BUCBP Hypothetical protein bbp030 28 6.4
>sp|O51035|Y001_BORBU Hypothetical protein BB0001 Length = 190 Score = 28.5 bits (62), Expect = 4.9 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 11/64 (17%) Frame = -3 Query: 175 MFYCNYHKRIIFNESYLIVI-----------IHINFSFYNCFEIDIFEIFLSQFLKTVSF 29 + Y NY I +NE+Y + I I FS N F I + F+S ++F Sbjct: 45 IIYHNYINSIFYNENYKYIAFIGILTSYNEWIEIQFSPINFFTIPTNKDFISNTYFNLAF 104 Query: 28 TIQI 17 TI I Sbjct: 105 TIYI 108
>sp|Q89B25|Y030_BUCBP Hypothetical protein bbp030 Length = 267 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -3 Query: 172 FYCNYHKRIIFNESYLIV----IIHINFSFYNCFEI 77 F C K+++ E Y+I ++++FSF NC EI Sbjct: 149 FTCKNVKKLLCLEKYIISHWGKYVNVSFSFLNCLEI 184
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,123,858 Number of Sequences: 369166 Number of extensions: 150756 Number of successful extensions: 452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 68,354,980 effective HSP length: 34 effective length of database: 62,073,990 effective search space used: 1675997730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)