Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00310 (719 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P33761|DPO3B_BORBU DNA polymerase III, beta chain 30 5.0 sp|P18571|VS11_ROTGA Nonstructural protein 30 5.0
>sp|P33761|DPO3B_BORBU DNA polymerase III, beta chain Length = 385 Score = 30.4 bits (67), Expect = 5.0 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 150 NYQDDKAFLERYLKKESTVSKPSIKDRIARLN 245 NY D K+ + + K +S VS +KDR+AR+N Sbjct: 256 NYPDYKSIIPKEQKNKSLVSLGILKDRLARVN 287
>sp|P18571|VS11_ROTGA Nonstructural protein Length = 170 Score = 30.4 bits (67), Expect = 5.0 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +3 Query: 39 SKMNVDGVRKWLDNQIMIGNGKDAQLINNEFC----INRPRNYQDDKAFLERYLKKESTV 206 S+ N L + M+ DA+ N EF ++RP + DK++ E K + Sbjct: 52 SRSNYSDAYDKLKREPMVEESNDAKYRNFEFSEDEEVHRPSSKASDKSYREMKRKHDDIN 111 Query: 207 SKPSIKDRIARLN 245 + SI ++++ LN Sbjct: 112 TSDSILEKLSELN 124
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 72,066,422
Number of Sequences: 369166
Number of extensions: 1313722
Number of successful extensions: 2322
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2293
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2322
length of database: 68,354,980
effective HSP length: 107
effective length of database: 48,588,335
effective search space used: 6413660220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)