Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_G16 (301 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P39016|MPT5_YEAST Suppressor protein MPT5 (HTR1 protein) 30 2.2 sp|P22456|ACHAA_XENLA Acetylcholine receptor protein, alpha... 28 6.4
>sp|P39016|MPT5_YEAST Suppressor protein MPT5 (HTR1 protein) Length = 834 Score = 29.6 bits (65), Expect = 2.2 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 11/83 (13%) Frame = -2 Query: 258 ITKILKESLLDILIIGISQDQSA---VISVPNEMN--------IFKFQVKFDSC*FPLTV 112 I + E +D++I G SQ+ ++ V+++ N++N IFKF V Sbjct: 281 IDTVDNEVQIDLIIKGFSQEFTSIEQVVTLINDLNGNHVIQKCIFKFSPSKFGFIIDAIV 340 Query: 111 NRNNTNHETSHKSSCAVQVKLFN 43 +NN ++HK C V KL + Sbjct: 341 EQNNIITISTHKHGCCVLQKLLS 363
>sp|P22456|ACHAA_XENLA Acetylcholine receptor protein, alpha-1-A subunit precursor Length = 457 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 91 VIRVISVNS*RKLTTVEFYLK--FEYVHLIWD-TDHGGL 198 +I++I+VN ++ T LK +E VHL WD D+GG+ Sbjct: 57 LIQLINVNEVNQIVTTNVRLKQQWEDVHLKWDPEDYGGI 95
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,092,680 Number of Sequences: 369166 Number of extensions: 525325 Number of successful extensions: 906 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 68,354,980 effective HSP length: 69 effective length of database: 55,608,265 effective search space used: 1668247950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)