Dr_sW_025_K01
	
		- ACCESSION : BW642847
 
		- GO Category :
Not Available
		
 
		- EST Sequence : 
 
	
	
	
	BLASTX 2.2.12 [Aug-07-2005]
	
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_025_K01
         (385 letters)
Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
sp|Q00362|2ABA_YEAST  Protein phosphatase PP2A regulatory su...    28   8.5  
>sp|Q00362|2ABA_YEAST Protein phosphatase PP2A regulatory subunit B (PR55) (Cell division
           control protein 55)
          Length = 526
 Score = 27.7 bits (60), Expect = 8.5
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = -3
Query: 131 KVLLDSFDNKMDCTTQFMTAFVIHDLKFEYV 39
           +V+L    N   C  +F+T F  HD +F+Y+
Sbjct: 48  RVVLFERSNSRHCEYKFLTEFQSHDAEFDYL 78
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,617,239
Number of Sequences: 369166
Number of extensions: 718881
Number of successful extensions: 1270
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1259
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1270
length of database: 68,354,980
effective HSP length: 94
effective length of database: 50,989,890
effective search space used: 1682666370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)