Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_002_G16 (667 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P33761|DPO3B_BORBU DNA polymerase III, beta chain 30 4.3 sp|P41001|TOP2_PLAFK DNA topoisomerase 2 (DNA topoisomerase... 29 9.7 sp|P18571|VS11_ROTGA Nonstructural protein 29 9.7 sp|Q12142|ATG9_YEAST Autophagy-related protein 9 (Cytoplasm... 29 9.7
>sp|P33761|DPO3B_BORBU DNA polymerase III, beta chain Length = 385 Score = 30.4 bits (67), Expect = 4.3 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 106 NYQDDKAFLERYLKKESTVSKPSIKDRIARLN 201 NY D K+ + + K +S VS +KDR+AR+N Sbjct: 256 NYPDYKSIIPKEQKNKSLVSLGILKDRLARVN 287
>sp|P41001|TOP2_PLAFK DNA topoisomerase 2 (DNA topoisomerase II) Length = 1398 Score = 29.3 bits (64), Expect = 9.7 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 73 INNEFCINRPRNYQDDKAFLERYLKKESTVSKPSIKDRIARLNN 204 I EFC R + Y++ K++L L+KE + K +A +NN Sbjct: 1040 ILKEFCYQRLKAYENRKSYLISKLEKEKRIISNKTKFILAIVNN 1083
>sp|P18571|VS11_ROTGA Nonstructural protein Length = 170 Score = 29.3 bits (64), Expect = 9.7 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 4/62 (6%) Frame = +1 Query: 28 LDNQIMIGNGKDAQLINNEFC----INRPRNYQDDKAFLERYLKKESTVSKPSIKDRIAR 195 L + M+ DA+ N EF ++RP + DK++ E K + + SI ++++ Sbjct: 63 LKREPMVEESNDAKYRNFEFSEDEEVHRPSSKASDKSYREMKRKHDDINTSDSILEKLSE 122 Query: 196 LN 201 LN Sbjct: 123 LN 124
>sp|Q12142|ATG9_YEAST Autophagy-related protein 9 (Cytoplasm to vacuole targeting protein 7) Length = 997 Score = 29.3 bits (64), Expect = 9.7 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +1 Query: 448 IYDWFRGSCYFC*QLEEINNCRILLEI*ICSSHLGH 555 +Y+++ G+ ++C LE+I N LL + S+++GH Sbjct: 310 VYNYYLGNGFYCIILEKILNICTLLFVVFVSTYMGH 345
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,062,408 Number of Sequences: 369166 Number of extensions: 1196142 Number of successful extensions: 1993 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1993 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5608903050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)