DrC_00307
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00307 (903 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9PJM5|RL24_CHLMU 50S ribosomal protein L24 34 0.49 sp|P28537|RL24_CHLTR 50S ribosomal protein L24 32 2.4 sp|O75592|MYCB2_HUMAN Probable ubiquitin ligase protein MYC... 32 2.4 sp|O14207|YDT2_SCHPO Hypothetical protein C6B12.02c in chro... 32 3.2 sp|Q7TPH6|MYCB2_MOUSE Probable ubiquitin ligase protein MYC... 32 3.2 sp|Q6B2C0|MTAL2_YEAST Mating-type protein ALPHA2 (MATalpha2... 31 5.4 sp|Q7NB79|MRAW_MYCGA S-adenosyl-methyltransferase mraW 31 5.4 sp|P48602|VATA1_DROME Vacuolar ATP synthase catalytic subun... 30 7.1 sp|P20646|PPAP_RAT Prostatic acid phosphatase precursor 30 7.1
>sp|Q9PJM5|RL24_CHLMU 50S ribosomal protein L24 Length = 111 Score = 34.3 bits (77), Expect = 0.49 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +2 Query: 53 LCLGNTIVNVAKNKPVIYGSIKDGIKETLANDGIID--KNCFMSKDIGEKTWEVNLLYSI 226 +C+G+T+ +A N G + +K+ + +GI KN S++ K +N+ + Sbjct: 6 VCVGDTVYVLAGNDKGKQGKVLRCLKDKVVVEGINVRVKNIKRSQE-NPKGKRINIEAPL 64 Query: 227 HVTELELYSDNDPSELRISITSQTKK 304 H++ + L DN P+ L + +T + ++ Sbjct: 65 HISNVRLSIDNQPARLFVKVTEKGRE 90
>sp|P28537|RL24_CHLTR 50S ribosomal protein L24 Length = 111 Score = 32.0 bits (71), Expect = 2.4 Identities = 20/86 (23%), Positives = 44/86 (51%), Gaps = 2/86 (2%) Frame = +2 Query: 53 LCLGNTIVNVAKNKPVIYGSIKDGIKETLANDGIID--KNCFMSKDIGEKTWEVNLLYSI 226 +C+G+T+ +A N G + +K+ + +GI KN S++ K +N+ + Sbjct: 6 VCVGDTVYVLAGNDKGKQGKVLRCLKDKVVVEGINVRVKNIKRSQE-NPKGKRINIEAPL 64 Query: 227 HVTELELYSDNDPSELRISITSQTKK 304 H++ + L DN P+ L + + + ++ Sbjct: 65 HISNVRLSIDNQPARLFVKVREKGRE 90
>sp|O75592|MYCB2_HUMAN Probable ubiquitin ligase protein MYCBP2 (Myc binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4641 Score = 32.0 bits (71), Expect = 2.4 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 7/105 (6%) Frame = +2 Query: 5 NFMILLVTGLLPILVELCLG------NTIVNV-AKNKPVIYGSIKDGIKETLANDGIIDK 163 +F I + +G + ELC+ +IV++ ++P + GS+ DG ET G DK Sbjct: 3680 SFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDK 3739 Query: 164 NCFMSKDIGEKTWEVNLLYSIHVTELELYSDNDPSELRISITSQT 298 N K +N + I+ + ++ DN +L +TS T Sbjct: 3740 N-------KTKNITINCVKGINARYVSVHVDNS-RDLGNKVTSMT 3776
>sp|O14207|YDT2_SCHPO Hypothetical protein C6B12.02c in chromosome I Length = 1888 Score = 31.6 bits (70), Expect = 3.2 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = -2 Query: 755 FSLEQFIFLTTNKLKSNNELIVNILPYFFKKKLISLSFLEDSKYIW*LESELK*GKVE*T 576 F+++ +F T KLK E ++ LPYF + + L L + L S++ G V Sbjct: 717 FNIQDDVFKTFEKLKDTFETVLENLPYFTNSETVDLYNLLSFCSAFILHSQVSMGLVNLA 776 Query: 575 NSF 567 +SF Sbjct: 777 SSF 779
>sp|Q7TPH6|MYCB2_MOUSE Probable ubiquitin ligase protein MYCBP2 (Myc binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4711 Score = 31.6 bits (70), Expect = 3.2 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 7/105 (6%) Frame = +2 Query: 5 NFMILLVTGLLPILVELCLG------NTIVNV-AKNKPVIYGSIKDGIKETLANDGIIDK 163 +F I + +G + ELC+ +IV++ ++P + GS+ DG ET G DK Sbjct: 3750 SFSISVQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDK 3809 Query: 164 NCFMSKDIGEKTWEVNLLYSIHVTELELYSDNDPSELRISITSQT 298 N K +N + I+ + ++ DN +L +TS T Sbjct: 3810 N-------KTKNITINCVKGINARYVSVHVDNS-RDLGNKVTSMT 3846
>sp|Q6B2C0|MTAL2_YEAST Mating-type protein ALPHA2 (MATalpha2 protein) (Alpha-2 repressor) Length = 210 Score = 30.8 bits (68), Expect = 5.4 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -1 Query: 285 IEIRNSLGSLSEYNSNSVTWIEYSKL---TSQVFSPISLLIKQFLSIIPSFANVSL 127 +E+R+ LG LS N N E KL TSQ+ + I++L+K+ SI +N L Sbjct: 49 VELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQL 104
>sp|Q7NB79|MRAW_MYCGA S-adenosyl-methyltransferase mraW Length = 317 Score = 30.8 bits (68), Expect = 5.4 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%) Frame = +2 Query: 44 LVELCLGNTIVNVAKNKPVIYGSIKDGIKETLANDGIIDKNCFMSKDIGEKTWEVNLLYS 223 L++ + +V + KN YG IKD + +A K F K++ T EV L Sbjct: 146 LIQNSTVSELVKIMKN----YGEIKDPYRVVVAL-----KKAFEKKELN--TLEVVELIK 194 Query: 224 IHVTELELYSDNDPSE-----LRISITSQ 295 HV + ELY++ P+ LRI++ ++ Sbjct: 195 KHVNKAELYANKHPARRYFQALRIAVNNE 223
>sp|P48602|VATA1_DROME Vacuolar ATP synthase catalytic subunit A isoform 1 (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) Length = 614 Score = 30.4 bits (67), Expect = 7.1 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 12/83 (14%) Frame = +2 Query: 95 PVIYGSIKDGIKETLANDGIIDKNCFMSKDIG------EKTWE---VNLLYSIHVTELEL 247 P I GSI DGI+ L + G++ + ++ K + + WE +N+ H+T +L Sbjct: 90 PGIMGSIFDGIQRPLRDIGVMTNSIYIPKGVNTTALSRSEMWEFNPLNVRVGSHITGGDL 149 Query: 248 YS---DNDPSELRISITSQTKKT 307 Y +N + R+ + + K T Sbjct: 150 YGVVHENTLVKQRMIVAPRAKGT 172
>sp|P20646|PPAP_RAT Prostatic acid phosphatase precursor Length = 381 Score = 30.4 bits (67), Expect = 7.1 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = +2 Query: 221 SIHVTELELYSDNDPSELRISITSQTKKTKFPVAAKSCANGCKIPIKKDAE 373 S H+ +ELY DN + + + ++T+ +P+ C + C P++K AE Sbjct: 311 SCHI--MELYQDNGGTFVEMYYRNETQNEPYPLTLPGCTHSC--PLEKFAE 357
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 79,774,501
Number of Sequences: 369166
Number of extensions: 1365997
Number of successful extensions: 3739
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3612
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3735
length of database: 68,354,980
effective HSP length: 110
effective length of database: 48,034,130
effective search space used: 9126484700
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
