Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_021_P22 (825 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O14207|YDT2_SCHPO Hypothetical protein C6B12.02c in chro... 32 2.8 sp|Q6B2C0|MTAL2_YEAST Mating-type protein ALPHA2 (MATalpha2... 31 4.7 sp|P48602|VATA1_DROME Vacuolar ATP synthase catalytic subun... 30 6.2 sp|P20646|PPAP_RAT Prostatic acid phosphatase precursor 30 6.2 sp|Q7NB79|MRAW_MYCGA S-adenosyl-methyltransferase mraW 30 6.2
>sp|O14207|YDT2_SCHPO Hypothetical protein C6B12.02c in chromosome I Length = 1888 Score = 31.6 bits (70), Expect = 2.8 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = -2 Query: 689 FSLEQFIFLTTNKLKSNNELIVNILPYFFKKKLISLSFLEDSKYIW*LESELK*GKVE*T 510 F+++ +F T KLK E ++ LPYF + + L L + L S++ G V Sbjct: 717 FNIQDDVFKTFEKLKDTFETVLENLPYFTNSETVDLYNLLSFCSAFILHSQVSMGLVNLA 776 Query: 509 NSF 501 +SF Sbjct: 777 SSF 779
>sp|Q6B2C0|MTAL2_YEAST Mating-type protein ALPHA2 (MATalpha2 protein) (Alpha-2 repressor) Length = 210 Score = 30.8 bits (68), Expect = 4.7 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -1 Query: 219 IEIRNSLGSLSEYNSNSVTWIEYSKL---TSQVFSPISLLIKQFLSIIPSFANVSL 61 +E+R+ LG LS N N E KL TSQ+ + I++L+K+ SI +N L Sbjct: 49 VELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQL 104
>sp|P48602|VATA1_DROME Vacuolar ATP synthase catalytic subunit A isoform 1 (V-ATPase A subunit 1) (Vacuolar proton pump alpha subunit 1) (V-ATPase 69 kDa subunit 1) Length = 614 Score = 30.4 bits (67), Expect = 6.2 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 12/83 (14%) Frame = +2 Query: 29 PVIYGSIKDGIKETLANDGIIDKNCFMSKDIG------EKTWE---VNLLYSIHVTELEL 181 P I GSI DGI+ L + G++ + ++ K + + WE +N+ H+T +L Sbjct: 90 PGIMGSIFDGIQRPLRDIGVMTNSIYIPKGVNTTALSRSEMWEFNPLNVRVGSHITGGDL 149 Query: 182 YS---DNDPSELRISITSQTKKT 241 Y +N + R+ + + K T Sbjct: 150 YGVVHENTLVKQRMIVAPRAKGT 172
>sp|P20646|PPAP_RAT Prostatic acid phosphatase precursor Length = 381 Score = 30.4 bits (67), Expect = 6.2 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = +2 Query: 155 SIHVTELELYSDNDPSELRISITSQTKKTKFPVAAKSCANGCKIPIKKDAE 307 S H+ +ELY DN + + + ++T+ +P+ C + C P++K AE Sbjct: 311 SCHI--MELYQDNGGTFVEMYYRNETQNEPYPLTLPGCTHSC--PLEKFAE 357
>sp|Q7NB79|MRAW_MYCGA S-adenosyl-methyltransferase mraW Length = 317 Score = 30.4 bits (67), Expect = 6.2 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Frame = +2 Query: 5 IVNVAKNKPVIYGSIKDGIKETLANDGIIDKNCFMSKDIGEKTWEVNLLYSIHVTELELY 184 +V + KN YG IKD + +A K F K++ T EV L HV + ELY Sbjct: 155 LVKIMKN----YGEIKDPYRVVVAL-----KKAFEKKELN--TLEVVELIKKHVNKAELY 203 Query: 185 SDNDPSE-----LRISITSQ 229 ++ P+ LRI++ ++ Sbjct: 204 ANKHPARRYFQALRIAVNNE 223
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,472,246 Number of Sequences: 369166 Number of extensions: 1215651 Number of successful extensions: 3292 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3290 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 7956112725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)