Planarian EST Database

Dr_sW_014_N11

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_014_N11
         (101 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|O75153|IF3X_HUMAN  Putative eukaryotic translation initia...    28   6.4  

>sp|O75153|IF3X_HUMAN Putative eukaryotic translation initiation factor 3 subunit (eIF-3)
          Length = 1309

 Score = 28.1 bits (61), Expect = 6.4
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 4   EKTGSSALQLCEVKVFSEIMVAQDGPTPSTGE 99
           E+ GSSA  L +VK  +E + A DG  P + E
Sbjct: 665 EEEGSSASGLAKVKELAETIAADDGTDPRSRE 696

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.308    0.126    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,687,625
Number of Sequences: 369166
Number of extensions: 91841
Number of successful extensions: 139
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 139
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 139
length of database: 68,354,980
effective HSP length: 8
effective length of database: 66,877,100
effective search space used: 1671927500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)