Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01087 (390 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8D2H4|LPXB_WIGBR Lipid-A-disaccharide synthase 32 0.34 sp|Q86WR7|CJ047_HUMAN Protein C10orf47 31 0.99 sp|O80948|MB23_ARATH Myrosinase binding protein-like At2g39330 28 4.9 sp|P00723|BGAL_KLULA Beta-galactosidase (Lactase) 28 6.4 sp|Q9UW81|NOP1_NEUCR Opsin-1 (NR) 28 6.4 sp|P30543|AA2AR_RAT Adenosine A2a receptor 28 8.4
>sp|Q8D2H4|LPXB_WIGBR Lipid-A-disaccharide synthase Length = 385 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +3 Query: 66 NLKKLRM*LHLLNKLITS*MKKLKRECGPDVPM---DNFVCAMVACA 197 N+ L++ + ++N L+ +++KRE PD+P+ DNF ++AC+ Sbjct: 220 NIFNLKILVPMVNSLLKKRFEEIKREVAPDLPITIFDNFSYEVMACS 266
>sp|Q86WR7|CJ047_HUMAN Protein C10orf47 Length = 435 Score = 30.8 bits (68), Expect = 0.99 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +2 Query: 68 SEETKDVITSFEQIDNVLNEEVKARMWTRCADGQFRLCYGSVCYICSYTFWSYWSRTCEP 247 + E KDV+ FE+ + L+E+ + + LC G VC +CS + S EP Sbjct: 55 THEEKDVLLFFEETIDSLDEDFEEPV----------LCDGGVCCLCSPSLEESTSSPSEP 104 Query: 248 RD 253 D Sbjct: 105 ED 106
>sp|O80948|MB23_ARATH Myrosinase binding protein-like At2g39330 Length = 459 Score = 28.5 bits (62), Expect = 4.9 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = -1 Query: 147 HILALTSSFRTLSICSKDVITSLV 76 HI+A+ ++R +++C+ +VIT+LV Sbjct: 76 HIIAVEGNYRGVALCATEVITNLV 99
>sp|P00723|BGAL_KLULA Beta-galactosidase (Lactase) Length = 1025 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 206 SYTFWSYWSRTCEPRDFKCWR*VNM 280 S TFW + EPRDFK W+ N+ Sbjct: 785 SITFWRPPTNNDEPRDFKNWKKYNI 809
>sp|Q9UW81|NOP1_NEUCR Opsin-1 (NR) Length = 304 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 194 TRYHSTNEIVHRHIWSTFSL*LLHSG 117 T Y + E HR +W TF+L +L SG Sbjct: 34 TEYQTLGETGHRTLWVTFALMVLSSG 59
>sp|P30543|AA2AR_RAT Adenosine A2a receptor Length = 410 Score = 27.7 bits (60), Expect = 8.4 Identities = 26/106 (24%), Positives = 43/106 (40%) Frame = +2 Query: 11 RIFFLIAVCISQIVCKTLKSEETKDVITSFEQIDNVLNEEVKARMWTRCADGQFRLCYGS 190 RIF + Q+ + L E T+ + L +EV A G F LC+ Sbjct: 194 RIFLAARRQLKQMESQPLPGERTR----------STLQKEVHAAKSLAIIVGLFALCWLP 243 Query: 191 VCYICSYTFWSYWSRTCEPRDFKCWR*VNMFYCIVINHVDKVLNVY 328 + I +TF+ R P W M+ I+++H + V+N + Sbjct: 244 LHIINCFTFFCSTCRHAPP-----WL---MYLAIILSHSNSVVNPF 281
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,322,192
Number of Sequences: 369166
Number of extensions: 706623
Number of successful extensions: 1957
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1918
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1957
length of database: 68,354,980
effective HSP length: 96
effective length of database: 50,620,420
effective search space used: 1670473860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)