Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_M15 (381 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q5ZKU8|PK1IP_CHICK p21-activated protein kinase-interact... 28 5.0 sp|Q9Z7E8|FOLKP_CHLPN Folate synthesis bifunctional protein... 28 5.0 sp|Q8D2H4|LPXB_WIGBR Lipid-A-disaccharide synthase 28 6.5 sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 28 8.5
>sp|Q5ZKU8|PK1IP_CHICK p21-activated protein kinase-interacting protein 1-like (PAK1-interacting protein 1-like) Length = 369 Score = 28.5 bits (62), Expect = 5.0 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -3 Query: 247 EVHKFYSSKTKMCMCRYSSRSHSTKEI 167 E+ +FYS ++ C+C + +R + K+I Sbjct: 218 EIIRFYSCDSQKCLCEFKARENRIKDI 244
>sp|Q9Z7E8|FOLKP_CHLPN Folate synthesis bifunctional protein [Includes: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) (HPPK) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (PPPK); Dihydropteroate synthase (DHPS) (Dihydropteroate pyrophosphorylase)] Length = 450 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +1 Query: 79 KDVITSFEQIDNVLNEKVKARMWTRCADGQFLLCYGSESYICTYT 213 ++++ + +QI+ V+ ++ W+ +L YG ES+ C +T Sbjct: 75 RELLVTIKQIEKVVGRAEESPPWSPRTIDVDILLYGDESFCCDHT 119
>sp|Q8D2H4|LPXB_WIGBR Lipid-A-disaccharide synthase Length = 385 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +2 Query: 65 NLKKLRM*LHLLNKLITS*MKKLKRECGPDVPM---DNF 172 N+ L++ + ++N L+ +++KRE PD+P+ DNF Sbjct: 220 NIFNLKILVPMVNSLLKKRFEEIKREVAPDLPITIFDNF 258
>sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 Length = 599 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 253 SLEVHKFYSSKTKMCMCRYSSRSHSTKEIVHRHIWS 146 +L H+ S+ K +CR +S +K I++RH W+ Sbjct: 311 NLSRHQRTHSEEKPYLCRECGQSFRSKSILNRHQWT 346
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,317,471 Number of Sequences: 369166 Number of extensions: 731392 Number of successful extensions: 1987 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1987 length of database: 68,354,980 effective HSP length: 93 effective length of database: 51,174,625 effective search space used: 1688762625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)