Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_J01 (364 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8D2H4|LPXB_WIGBR Lipid-A-disaccharide synthase 35 0.042 sp|O80948|MB23_ARATH Myrosinase binding protein-like At2g39330 28 5.1 sp|Q9UW81|NOP1_NEUCR Opsin-1 (NR) 28 6.6
>sp|Q8D2H4|LPXB_WIGBR Lipid-A-disaccharide synthase Length = 385 Score = 35.4 bits (80), Expect = 0.042 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Frame = +1 Query: 43 NIYNLKKLRM*LHLLNKLITS*MKKLKRECGPDVPM---DNFVCAMVACAIHAYTHFGLT 213 NI+NLK L + ++N L+ +++KRE PD+P+ DNF ++AC+ + G Sbjct: 220 NIFNLKIL---VPMVNSLLKKRFEEIKREVAPDLPITIFDNFSYEVMACSDFSIVTSGTA 276 Query: 214 GVE 222 +E Sbjct: 277 TLE 279
>sp|O80948|MB23_ARATH Myrosinase binding protein-like At2g39330 Length = 459 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = -1 Query: 133 HILALTSSFRRLSICSKDVITSLV 62 HI+A+ ++R +++C+ +VIT+LV Sbjct: 76 HIIAVEGNYRGVALCATEVITNLV 99
>sp|Q9UW81|NOP1_NEUCR Opsin-1 (NR) Length = 304 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 180 TRYHSTNEIVHRHIWSTFSL*LLHSG 103 T Y + E HR +W TF+L +L SG Sbjct: 34 TEYQTLGETGHRTLWVTFALMVLSSG 59
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,320,766 Number of Sequences: 369166 Number of extensions: 739552 Number of successful extensions: 1706 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1706 length of database: 68,354,980 effective HSP length: 87 effective length of database: 52,283,035 effective search space used: 1725340155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)