Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00459 (615 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15... 63 7e-10 sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15... 55 1e-07 sp|P30938|SSR5_RAT Somatostatin receptor type 5 (SS5R) 34 0.26 sp|O08858|SSR5_MOUSE Somatostatin receptor type 5 (SS5R) 33 0.58 sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor 31 2.2 sp|Q08761|PROS_MOUSE Vitamin K-dependent protein S precursor 31 2.2 sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor 31 2.9 sp|P07225|PROS_HUMAN Vitamin K-dependent protein S precursor 31 2.9 sp|Q28520|PROS_MACMU Vitamin K-dependent protein S precursor 31 2.9 sp|P07224|PROS_BOVIN Vitamin K-dependent protein S precursor 30 4.9
>sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15 protein) Length = 115 Score = 62.8 bits (151), Expect = 7e-10 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = +1 Query: 22 WEHGLCGCFDDCGTCLL-TYFVPCYLIGKDAEAVGDSCFLCGLAALFAGPCIIAYVRSKV 198 W+ G+C CF DCG CL T+ PC +G A + C LCG + +R+ Sbjct: 26 WQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSVA---------MRTLY 74 Query: 199 RERRNISGNIFEDFICALCCNCCIVAQMHQEV 294 R R I G+I +D++ LCC C + Q+ +++ Sbjct: 75 RTRYGIPGSICDDYMATLCCPHCTLCQIKRDI 106
>sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15 protein) (Onzin) Length = 112 Score = 55.1 bits (131), Expect = 1e-07 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 1/92 (1%) Frame = +1 Query: 22 WEHGLCGCFDDCGTCLLTYFVPCY-LIGKDAEAVGDSCFLCGLAALFAGPCIIAYVRSKV 198 W+ LC CF DCG CL F C+ +G A + C LCG +R+ Sbjct: 23 WQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCGTTVA---------MRTLY 71 Query: 199 RERRNISGNIFEDFICALCCNCCIVAQMHQEV 294 R R I G+I +D++ L C C V Q+ +++ Sbjct: 72 RTRYGIPGSICDDYMVTLFCPVCSVCQLKRDI 103
>sp|P30938|SSR5_RAT Somatostatin receptor type 5 (SS5R) Length = 363 Score = 34.3 bits (77), Expect = 0.26 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 9/70 (12%) Frame = +3 Query: 3 RIRHEGMGTWSLWVF**LWNMFINIFCTVLFNWKRCRSRW*QLFSLWFSGFICWT----- 167 R R M + ++WVF L ++ + +F V W C W + LW + FI +T Sbjct: 150 RPRVAKMASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGF 209 Query: 168 ----LYYCIC 185 L C+C Sbjct: 210 FGPLLVICLC 219
>sp|O08858|SSR5_MOUSE Somatostatin receptor type 5 (SS5R) Length = 362 Score = 33.1 bits (74), Expect = 0.58 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 9/70 (12%) Frame = +3 Query: 3 RIRHEGMGTWSLWVF**LWNMFINIFCTVLFNWKRCRSRW*QLFSLWFSGFICWT----- 167 R R + + ++WVF L ++ + +F V W C W + LW + FI +T Sbjct: 149 RPRVAKLASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGF 208 Query: 168 ----LYYCIC 185 L C+C Sbjct: 209 FGPLLVICLC 218
>sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor Length = 675 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 269 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 364 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENNPETDYFYPK 84
>sp|Q08761|PROS_MOUSE Vitamin K-dependent protein S precursor Length = 675 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 269 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 364 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENNPETDYFYPK 84
>sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor Length = 646 Score = 30.8 bits (68), Expect = 2.9 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 269 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 364 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 25 LERECIEELCNKEE-AREVFENDPETDYFYPK 55
>sp|P07225|PROS_HUMAN Vitamin K-dependent protein S precursor Length = 676 Score = 30.8 bits (68), Expect = 2.9 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 269 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 364 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENDPETDYFYPK 84
>sp|Q28520|PROS_MACMU Vitamin K-dependent protein S precursor Length = 649 Score = 30.8 bits (68), Expect = 2.9 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 269 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 364 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 27 LERECIEELCNKEE-AREVFENDPETDYFYPK 57
>sp|P07224|PROS_BOVIN Vitamin K-dependent protein S precursor Length = 675 Score = 30.0 bits (66), Expect = 4.9 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 269 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 364 L +CI+ LC E+ A ++ EN P T++FY K Sbjct: 54 LERECIEELCNKEE-AREIFENNPETEYFYPK 84
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 66,065,158
Number of Sequences: 369166
Number of extensions: 1280510
Number of successful extensions: 3032
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2951
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3027
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4846822695
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)