Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_018_H08 (412 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15... 59 5e-09 sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15... 51 1e-06 sp|P30938|SSR5_RAT Somatostatin receptor type 5 (SS5R) 35 0.058 sp|O08858|SSR5_MOUSE Somatostatin receptor type 5 (SS5R) 35 0.076 sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor 31 0.84 sp|Q08761|PROS_MOUSE Vitamin K-dependent protein S precursor 31 0.84 sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor 31 1.1 sp|P07225|PROS_HUMAN Vitamin K-dependent protein S precursor 31 1.1 sp|Q28520|PROS_MACMU Vitamin K-dependent protein S precursor 31 1.1 sp|P82789|LC80_ARATH Putative low-molecular-weight cysteine... 30 1.4
>sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15 protein) Length = 115 Score = 58.5 bits (140), Expect = 5e-09 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 1/89 (1%) Frame = +1 Query: 28 GLCGCFDDCGTCLL-TYFVPCYLIGKDAEAVGDSCFLCGLAALFAGPCIIAYVRSKVRER 204 G+C CF DCG CL T+ PC +G A + C LCG + +R+ R R Sbjct: 29 GMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTSVA---------MRTLYRTR 77 Query: 205 RNISGNIFEDFICALCCNCCIVAQMHQEV 291 I G+I +D++ LCC C + Q+ +++ Sbjct: 78 YGIPGSICDDYMATLCCPHCTLCQIKRDI 106
>sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15 protein) (Onzin) Length = 112 Score = 50.8 bits (120), Expect = 1e-06 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = +1 Query: 31 LCGCFDDCGTCLLTYFVPCY-LIGKDAEAVGDSCFLCGLAALFAGPCIIAYVRSKVRERR 207 LC CF DCG CL F C+ +G A + C LCG +R+ R R Sbjct: 27 LCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCGTTVA---------MRTLYRTRY 75 Query: 208 NISGNIFEDFICALCCNCCIVAQMHQEV 291 I G+I +D++ L C C V Q+ +++ Sbjct: 76 GIPGSICDDYMVTLFCPVCSVCQLKRDI 103
>sp|P30938|SSR5_RAT Somatostatin receptor type 5 (SS5R) Length = 363 Score = 35.0 bits (79), Expect = 0.058 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 9/69 (13%) Frame = +3 Query: 3 PNSARGGTWSLWVF**LWNMFINIFCTVLFNWKRCRSRW*QLFSLWFSGFICWT------ 164 P A+ + ++WVF L ++ + +F V W C W + LW + FI +T Sbjct: 151 PRVAKMASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFF 210 Query: 165 ---LYYCIC 182 L C+C Sbjct: 211 GPLLVICLC 219
>sp|O08858|SSR5_MOUSE Somatostatin receptor type 5 (SS5R) Length = 362 Score = 34.7 bits (78), Expect = 0.076 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 9/69 (13%) Frame = +3 Query: 3 PNSARGGTWSLWVF**LWNMFINIFCTVLFNWKRCRSRW*QLFSLWFSGFICWT------ 164 P A+ + ++WVF L ++ + +F V W C W + LW + FI +T Sbjct: 150 PRVAKLASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFF 209 Query: 165 ---LYYCIC 182 L C+C Sbjct: 210 GPLLVICLC 218
>sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor Length = 675 Score = 31.2 bits (69), Expect = 0.84 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 266 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 361 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENNPETDYFYPK 84
>sp|Q08761|PROS_MOUSE Vitamin K-dependent protein S precursor Length = 675 Score = 31.2 bits (69), Expect = 0.84 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 266 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 361 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENNPETDYFYPK 84
>sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor Length = 646 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 266 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 361 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 25 LERECIEELCNKEE-AREVFENDPETDYFYPK 55
>sp|P07225|PROS_HUMAN Vitamin K-dependent protein S precursor Length = 676 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 266 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 361 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENDPETDYFYPK 84
>sp|Q28520|PROS_MACMU Vitamin K-dependent protein S precursor Length = 649 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 266 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 361 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 27 LERECIEELCNKEE-AREVFENDPETDYFYPK 57
>sp|P82789|LC80_ARATH Putative low-molecular-weight cysteine-rich protein LCR80 precursor Length = 122 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 1 CRIRHEGEHGLCGCFDDCGTCLLTYFVPC 87 C R+ G HG C DD CL Y PC Sbjct: 96 CAQRYNGGHGYCNTLDDFSLCLCKY--PC 122
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,508,477 Number of Sequences: 369166 Number of extensions: 935953 Number of successful extensions: 2571 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2568 length of database: 68,354,980 effective HSP length: 99 effective length of database: 50,066,215 effective search space used: 1852449955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)