Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_O10 (315 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor 31 0.77 sp|Q08761|PROS_MOUSE Vitamin K-dependent protein S precursor 31 0.77 sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor 31 1.0 sp|P07225|PROS_HUMAN Vitamin K-dependent protein S precursor 31 1.0 sp|Q28520|PROS_MACMU Vitamin K-dependent protein S precursor 31 1.0 sp|P07224|PROS_BOVIN Vitamin K-dependent protein S precursor 30 1.7 sp|Q14393|GAS6_HUMAN Growth-arrest-specific protein 6 precu... 30 2.2 sp|Q63772|GAS6_RAT Growth-arrest-specific protein 6 precurs... 28 5.0 sp|P33455|VGLM_SEOU8 M polyprotein precursor [Contains: Gly... 28 6.5 sp|Q90185|VNCS_AEDEB Noncapsid protein NS-1 (Nonstructural ... 28 6.5
>sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor Length = 675 Score = 31.2 bits (69), Expect = 0.77 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 260 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENNPETDYFYPK 84
>sp|Q08761|PROS_MOUSE Vitamin K-dependent protein S precursor Length = 675 Score = 31.2 bits (69), Expect = 0.77 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 260 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENNPETDYFYPK 84
>sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor Length = 646 Score = 30.8 bits (68), Expect = 1.0 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 260 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 25 LERECIEELCNKEE-AREVFENDPETDYFYPK 55
>sp|P07225|PROS_HUMAN Vitamin K-dependent protein S precursor Length = 676 Score = 30.8 bits (68), Expect = 1.0 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 260 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 54 LERECIEELCNKEE-AREVFENDPETDYFYPK 84
>sp|Q28520|PROS_MACMU Vitamin K-dependent protein S precursor Length = 649 Score = 30.8 bits (68), Expect = 1.0 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 260 L +CI+ LC E+ A ++ EN P TD+FY K Sbjct: 27 LERECIEELCNKEE-AREVFENDPETDYFYPK 57
>sp|P07224|PROS_BOVIN Vitamin K-dependent protein S precursor Length = 675 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFYIK 260 L +CI+ LC E+ A ++ EN P T++FY K Sbjct: 54 LERECIEELCNKEE-AREIFENNPETEYFYPK 84
>sp|Q14393|GAS6_HUMAN Growth-arrest-specific protein 6 precursor (GAS-6) Length = 721 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFY 254 L +C++ LC E+ A ++ EN P TD+FY Sbjct: 61 LERECVEELCSREE-AREVFENDPETDYFY 89
>sp|Q63772|GAS6_RAT Growth-arrest-specific protein 6 precursor (GAS-6) (Growth-potentiating factor) (GPF) Length = 674 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 165 LLHKCIKRLCQWEDRAWQLNENKPNTDFFY 254 L +C++ +C E+ A ++ EN P TD+FY Sbjct: 58 LERECVEEVCSKEE-AREVFENDPETDYFY 86
>sp|P33455|VGLM_SEOU8 M polyprotein precursor [Contains: Glycoprotein G1; Glycoprotein G2] Length = 1133 Score = 28.1 bits (61), Expect = 6.5 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +2 Query: 2 DAEAVGDSCFLCGLAALFAGPCIIAYVRSKVRERRNISGNIFEDFIC-ALCCNCCIVAQM 178 D VG C CGL P A+ VR R + E+++C + N C V + Sbjct: 767 DCPGVGTGCTACGLYLDQLKPVGTAFKIISVRYSRKVCVQFGEEYLCKTIDMNDCFVTR- 825 Query: 179 HQEVMSMG 202 H ++ +G Sbjct: 826 HAKICIIG 833
>sp|Q90185|VNCS_AEDEB Noncapsid protein NS-1 (Nonstructural protein NS1) (NCVP1) Length = 805 Score = 28.1 bits (61), Expect = 6.5 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 45 RLYLLDPVLLHMFDLKFVNDVILVEIFSR----ISFVHFAVTVVLLHKCIKRLCQWEDRA 212 +LY+ + H D +N I ++ SR + +H A+ V K I +L + ED A Sbjct: 691 KLYIFKKSIQHREDKYTINAQIQNKLISRPPGLVEPIHMAIVFVKNFKEIYKLIEEEDNA 750 Query: 213 WQLNE 227 +NE Sbjct: 751 HTVNE 755
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,734,496 Number of Sequences: 369166 Number of extensions: 595869 Number of successful extensions: 1501 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1498 length of database: 68,354,980 effective HSP length: 73 effective length of database: 54,869,325 effective search space used: 1700949075 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)