DrC_01006
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01006 (594 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O15162|PLS1_HUMAN Phospholipid scramblase 1 (PL scrambla... 35 0.19 sp|Q02308|HLES_DROME Hairless protein 30 3.5 sp|Q62203|SF3A2_MOUSE Splicing factor 3A subunit 2 (Spliceo... 30 4.6 sp|Q04637|IF4G1_HUMAN Eukaryotic translation initiation fac... 30 4.6 sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Spliceo... 29 7.8
>sp|O15162|PLS1_HUMAN Phospholipid scramblase 1 (PL scramblase 1) (Ca(2+)-dependent phospholipid scramblase 1) (Erythrocyte phospholipid scramblase) (MmTRA1b) Length = 318 Score = 34.7 bits (78), Expect = 0.19 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 360 PPAQCTYPQGQTVYPPPPIGNSDYQRAAYPV 452 PP YP Q YPPPP G+S A +PV Sbjct: 33 PPGYSGYPGPQVSYPPPPAGHSGPGPAGFPV 63
>sp|Q02308|HLES_DROME Hairless protein Length = 1077 Score = 30.4 bits (67), Expect = 3.5 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 341 PGSNILSTSPVHISTRPNRISSS 409 PGS+ STSP +ST+P R++SS Sbjct: 640 PGSSSSSTSPATLSTQPTRLNSS 662
>sp|Q62203|SF3A2_MOUSE Splicing factor 3A subunit 2 (Spliceosome associated protein 62) (SAP 62) (SF3a66) Length = 475 Score = 30.0 bits (66), Expect = 4.6 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = +3 Query: 318 PAAVTVISQDQTYYPPAQCTYPQGQTVYPPPPIGNSDYQRAAYP----VYPTN 464 P A V Q +PPA +PQ V+P PP G +P V+P+N Sbjct: 392 PPAPAVHPQAPGVHPPAPGIHPQAPGVHPQPPPGVHPAAPGVHPQPPGVHPSN 444
>sp|Q04637|IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G1) (eIF-4G 1) (p220) Length = 1600 Score = 30.0 bits (66), Expect = 4.6 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = +3 Query: 273 SARTGIQRRGRVVAQPAAVTVISQDQTYYPPAQCTYPQGQTVYPPPPIGNSDY--QRAAY 446 SA + +Q PAA + Q P+Q +YP Q Y P G S Y Y Sbjct: 61 SAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQY 120 Query: 447 PVYP 458 PV P Sbjct: 121 PVQP 124
>sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Spliceosome associated protein 62) (SAP 62) (SF3a66) Length = 464 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 318 PAAVTVISQDQTYYPPAQCTYPQGQTVYPPPP 413 PAA V Q +PPA +PQ V+P PP Sbjct: 381 PAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPP 412
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 62,399,906
Number of Sequences: 369166
Number of extensions: 1100902
Number of successful extensions: 3432
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 3208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3414
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4504118060
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
