Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00529 (1228 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-relate... 32 4.9 sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) 32 4.9 sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) 32 4.9
>sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-related protein precursor (LRP) Length = 4753 Score = 31.6 bits (70), Expect = 4.9 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +1 Query: 556 CMSRPVFHLKFYFSSRSFDNVCSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIKSS 735 C + L F S S N KC RQ F + N C+ + +E + SS Sbjct: 1001 CRASQCTQLCFATPSESHPNELEAKCA----CRQGFMINKENNHSCQKDPAEKIEQLCSS 1056 Query: 736 NRVDQNCKSIRC---ENKCFG 789 N CK+ RC E KC G Sbjct: 1057 NSTQFQCKNGRCIPKEWKCDG 1077
>sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) Length = 755 Score = 31.6 bits (70), Expect = 4.9 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 479 FIGDCRIGHFLKII*RNMFIIWL 547 F+GD ++GH++KI R+MFI+ L Sbjct: 528 FVGDFKLGHYMKIPPRSMFIVQL 550
>sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) Length = 753 Score = 31.6 bits (70), Expect = 4.9 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 479 FIGDCRIGHFLKII*RNMFIIWL 547 F+GD ++GH++KI R+MFI+ L Sbjct: 526 FVGDFKLGHYMKIPPRSMFIVQL 548
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 135,201,394 Number of Sequences: 369166 Number of extensions: 2788574 Number of successful extensions: 6611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6608 length of database: 68,354,980 effective HSP length: 113 effective length of database: 47,479,925 effective search space used: 14006577875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)