Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_N16 (777 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-relate... 32 2.5 sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) 32 2.5 sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) 32 2.5 sp|Q9J584|MCEL_FOWPV mRNA capping enzyme large subunit [Inc... 30 5.6 sp|Q87MY0|MOAA_VIBPA Molybdenum cofactor biosynthesis prote... 30 5.6 sp|Q7MM75|MOAA_VIBVY Molybdenum cofactor biosynthesis prote... 30 5.6 sp|Q8D894|MOAA_VIBVU Molybdenum cofactor biosynthesis prote... 30 5.6 sp|P23456|RRPL_HANTV RNA-directed RNA polymerase (L protein) 30 7.4 sp|P28026|WNT8_XENLA Wnt-8 protein precursor (XWnt-8) 30 7.4 sp|P54523|DXS_BACSU 1-deoxy-D-xylulose-5-phosphate synthase... 30 9.6
>sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-related protein precursor (LRP) Length = 4753 Score = 31.6 bits (70), Expect = 2.5 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 383 CMSRPVFHLKFYFSSRSFDNVCSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIKSS 562 C + L F S S N KC RQ F + N C+ + +E + SS Sbjct: 1001 CRASQCTQLCFATPSESHPNELEAKCA----CRQGFMINKENNHSCQKDPAEKIEQLCSS 1056 Query: 563 NRVDQNCKSIRC---ENKCFG 616 N CK+ RC E KC G Sbjct: 1057 NSTQFQCKNGRCIPKEWKCDG 1077
>sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) Length = 755 Score = 31.6 bits (70), Expect = 2.5 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +3 Query: 306 FIGDCRIGHFLKII*RNMFIIWL 374 F+GD ++GH++KI R+MFI+ L Sbjct: 528 FVGDFKLGHYMKIPPRSMFIVQL 550
>sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) Length = 753 Score = 31.6 bits (70), Expect = 2.5 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +3 Query: 306 FIGDCRIGHFLKII*RNMFIIWL 374 F+GD ++GH++KI R+MFI+ L Sbjct: 526 FVGDFKLGHYMKIPPRSMFIVQL 548
>sp|Q9J584|MCEL_FOWPV mRNA capping enzyme large subunit [Includes: Polynucleotide 5'-triphosphatase (mRNA 5'-triphosphatase) (TPase); mRNA guanylyltransferase (GTP--RNA guanylyltransferase) (GTase)] Length = 851 Score = 30.4 bits (67), Expect = 5.6 Identities = 12/57 (21%), Positives = 29/57 (50%) Frame = +2 Query: 5 SAYLELDVQLREEGFGRHKVYESLEVTDDYALINVPKFHLKFGTFQSVKTLHVFKKQ 175 S Y+E ++ ++++ + K+ E L ++ ++ PK+ + + H+ KKQ Sbjct: 195 SLYIEFEIMMQDKNISKKKLLEELNMSASALFLSHPKYIRLCPSINPILRTHLLKKQ 251
>sp|Q87MY0|MOAA_VIBPA Molybdenum cofactor biosynthesis protein A Length = 334 Score = 30.4 bits (67), Expect = 5.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 401 FHLKFYFSSRSFDNVCSKKCTDC 469 FH KFY+ S +VC+ KCT C Sbjct: 14 FHRKFYYLRLSVTDVCNFKCTYC 36
>sp|Q7MM75|MOAA_VIBVY Molybdenum cofactor biosynthesis protein A Length = 334 Score = 30.4 bits (67), Expect = 5.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 401 FHLKFYFSSRSFDNVCSKKCTDC 469 FH KFY+ S +VC+ KCT C Sbjct: 14 FHRKFYYLRLSVTDVCNFKCTYC 36
>sp|Q8D894|MOAA_VIBVU Molybdenum cofactor biosynthesis protein A Length = 334 Score = 30.4 bits (67), Expect = 5.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 401 FHLKFYFSSRSFDNVCSKKCTDC 469 FH KFY+ S +VC+ KCT C Sbjct: 14 FHRKFYYLRLSVTDVCNFKCTYC 36
>sp|P23456|RRPL_HANTV RNA-directed RNA polymerase (L protein) Length = 2151 Score = 30.0 bits (66), Expect = 7.4 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 419 FSSRSFDNVCSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIK 556 +S+ S D + T C ++Y + +NG+HC V K ++ K Sbjct: 1440 YSATSQDMDLFQTLTSCTFSKEYAWKDFLNGIHCDVIPTKQVQRAK 1485
>sp|P28026|WNT8_XENLA Wnt-8 protein precursor (XWnt-8) Length = 358 Score = 30.0 bits (66), Expect = 7.4 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = +2 Query: 446 CSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIKSSNRVDQNCKSIRCENKCFGRK 622 C + CTDC L + K EI++ +CK C ++ + CK + ++ C R+ Sbjct: 291 CKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVK--------CEQCKQVVIKHFCARRE 341
>sp|P54523|DXS_BACSU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 633 Score = 29.6 bits (65), Expect = 9.6 Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = +2 Query: 281 PVPSQFTHFHWRLSHRPFSQDYLEKHVHNLAAAMCMS--RPVFHLKFYFSSRSFDNVCSK 454 PV S+ F R F E+H +AAAM M +P + F R++D V Sbjct: 344 PVGSKLEGFAKEFPDRMFDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYDQVVHD 403 Query: 455 KC 460 C Sbjct: 404 IC 405
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,582,611 Number of Sequences: 369166 Number of extensions: 1869959 Number of successful extensions: 4515 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4513 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 7260540000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)