Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_013_M17 (563 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) 32 1.4 sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) 32 1.4 sp|P32248|CCR7_HUMAN C-C chemokine receptor type 7 precurso... 29 9.2
>sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) Length = 755 Score = 31.6 bits (70), Expect = 1.4 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 479 FIGDCRIGHFLKII*RNMFIIWL 547 F+GD ++GH++KI R+MFI+ L Sbjct: 528 FVGDFKLGHYMKIPPRSMFIVQL 550
>sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) Length = 753 Score = 31.6 bits (70), Expect = 1.4 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 479 FIGDCRIGHFLKII*RNMFIIWL 547 F+GD ++GH++KI R+MFI+ L Sbjct: 526 FVGDFKLGHYMKIPPRSMFIVQL 548
>sp|P32248|CCR7_HUMAN C-C chemokine receptor type 7 precursor (C-C CKR-7) (CC-CKR-7) (CCR-7) (MIP-3 beta receptor) (EBV-induced G-protein coupled receptor 1) (EBI1) (BLR2) (CD197 antigen) (CDw197) Length = 378 Score = 28.9 bits (63), Expect = 9.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 250 EVTDDYALINVPKFHLKFGTFQSVKTLHVFKKQITVIQYNGMCFV 384 EVTDDY N + F + S K + FK I Y+ +CFV Sbjct: 27 EVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFV 71
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,715,358 Number of Sequences: 369166 Number of extensions: 1059065 Number of successful extensions: 2638 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2638 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 4078830820 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)