Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_F23 (850 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-relate... 32 2.9 sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) 32 2.9 sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) 32 2.9 sp|Q95BX6|MATK_ULMPA Maturase K (Intron maturase) 31 5.0 sp|Q87MY0|MOAA_VIBPA Molybdenum cofactor biosynthesis prote... 30 6.5 sp|Q7MM75|MOAA_VIBVY Molybdenum cofactor biosynthesis prote... 30 6.5 sp|Q8D894|MOAA_VIBVU Molybdenum cofactor biosynthesis prote... 30 6.5 sp|P23456|RRPL_HANTV RNA-directed RNA polymerase (L protein) 30 8.4 sp|P28026|WNT8_XENLA Wnt-8 protein precursor (XWnt-8) 30 8.4 sp|O98635|MATK_NUPVA Maturase K (Intron maturase) 30 8.4
>sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-related protein precursor (LRP) Length = 4753 Score = 31.6 bits (70), Expect = 2.9 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +3 Query: 459 CMSRPVFHLKFYFSSRSFDNVCSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIKSS 638 C + L F S S N KC RQ F + N C+ + +E + SS Sbjct: 1001 CRASQCTQLCFATPSESHPNELEAKCA----CRQGFMINKENNHSCQKDPAEKIEQLCSS 1056 Query: 639 NRVDQNCKSIRC---ENKCFG 692 N CK+ RC E KC G Sbjct: 1057 NSTQFQCKNGRCIPKEWKCDG 1077
>sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 (AtOPT1) Length = 755 Score = 31.6 bits (70), Expect = 2.9 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +1 Query: 382 FIGDCRIGHFLKII*RNMFIIWL 450 F+GD ++GH++KI R+MFI+ L Sbjct: 528 FVGDFKLGHYMKIPPRSMFIVQL 550
>sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 (AtOPT5) Length = 753 Score = 31.6 bits (70), Expect = 2.9 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +1 Query: 382 FIGDCRIGHFLKII*RNMFIIWL 450 F+GD ++GH++KI R+MFI+ L Sbjct: 526 FVGDFKLGHYMKIPPRSMFIVQL 548
>sp|Q95BX6|MATK_ULMPA Maturase K (Intron maturase) Length = 505 Score = 30.8 bits (68), Expect = 5.0 Identities = 35/138 (25%), Positives = 61/138 (44%), Gaps = 18/138 (13%) Frame = -3 Query: 566 EILSNQRTISTFLGTNIIK----RATAKVKFQMENRA*HAHCCSQIMNMF------L*II 417 EI + R +S+ GT I+K R+ + +E++ + + S ++ + L I Sbjct: 103 EIPFSIRLVSSLKGTEIVKYSNLRSIHSIFPFLEDKFPYLNSVSDVLIPYPIHLEILVQI 162 Query: 416 LRKWPMRQSPMKMCKL----RWNWSRSVVSNFIIPVFVKS----LVFKHRSNKTHTIVLN 261 LR W S + + +L +NW+ ++SN I +F KS +F + S H Sbjct: 163 LRYWVKDASSLHLLRLFLHDYYNWNSLIISNKSISIFFKSNSRFFLFLYNS---HVCEYE 219 Query: 260 NGNLFFEHMKCFN*LKSS 207 + LF + C L SS Sbjct: 220 SILLFIRNQSCHLRLTSS 237
>sp|Q87MY0|MOAA_VIBPA Molybdenum cofactor biosynthesis protein A Length = 334 Score = 30.4 bits (67), Expect = 6.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 477 FHLKFYFSSRSFDNVCSKKCTDC 545 FH KFY+ S +VC+ KCT C Sbjct: 14 FHRKFYYLRLSVTDVCNFKCTYC 36
>sp|Q7MM75|MOAA_VIBVY Molybdenum cofactor biosynthesis protein A Length = 334 Score = 30.4 bits (67), Expect = 6.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 477 FHLKFYFSSRSFDNVCSKKCTDC 545 FH KFY+ S +VC+ KCT C Sbjct: 14 FHRKFYYLRLSVTDVCNFKCTYC 36
>sp|Q8D894|MOAA_VIBVU Molybdenum cofactor biosynthesis protein A Length = 334 Score = 30.4 bits (67), Expect = 6.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 477 FHLKFYFSSRSFDNVCSKKCTDC 545 FH KFY+ S +VC+ KCT C Sbjct: 14 FHRKFYYLRLSVTDVCNFKCTYC 36
>sp|P23456|RRPL_HANTV RNA-directed RNA polymerase (L protein) Length = 2151 Score = 30.0 bits (66), Expect = 8.4 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 495 FSSRSFDNVCSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIK 632 +S+ S D + T C ++Y + +NG+HC V K ++ K Sbjct: 1440 YSATSQDMDLFQTLTSCTFSKEYAWKDFLNGIHCDVIPTKQVQRAK 1485
>sp|P28026|WNT8_XENLA Wnt-8 protein precursor (XWnt-8) Length = 358 Score = 30.0 bits (66), Expect = 8.4 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = +3 Query: 522 CSKKCTDCPLIRQYFKMEIVNGVHCKVCHCKPLENIKSSNRVDQNCKSIRCENKCFGRK 698 C + CTDC L + K EI++ +CK C ++ + CK + ++ C R+ Sbjct: 291 CKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVK--------CEQCKQVVIKHFCARRE 341
>sp|O98635|MATK_NUPVA Maturase K (Intron maturase) Length = 505 Score = 30.0 bits (66), Expect = 8.4 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 9/67 (13%) Frame = -2 Query: 846 LEQRVLHHYFVRDVLGK-------LLNYLETSV--APSICLLLVV*RDHHKHNEHNRPIS 694 LE ++ H Y+V D+L LL L T + APS+ LL +HH N P Sbjct: 139 LEDKLSHLYYVSDILIPHPIHLEILLQTLRTRIRDAPSLHLLRCFLHEHHNWNSLITPKK 198 Query: 693 YRNIYSR 673 +I+S+ Sbjct: 199 STSIFSK 205
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,960,509 Number of Sequences: 369166 Number of extensions: 1963045 Number of successful extensions: 4922 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4920 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8341863645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)