DrC_00304
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00304 (604 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P05085|ARGR2_YEAST Arginine metabolism regulation protei... 33 0.73 sp|O15027|K0310_HUMAN Protein KIAA0310 33 0.73 sp|P24361|VF09_VACCV Protein F9 32 1.6 sp|P68453|VF09_VACCP Protein F9 >gi|55977546|sp|P68452|VF09... 32 1.6 sp|P33869|VF09_VARV Protein F9 31 2.8 sp|P09152|NARG_ECOLI Respiratory nitrate reductase 1 alpha ... 30 3.6 sp|Q8Z1X1|RSMB_SALTI Ribosomal RNA small subunit methyltran... 30 3.6 sp|O97939|ENAM_PIG Enamelin precursor [Contains: 89 kDa ena... 30 3.6 sp|Q8ZLM5|RSMB_SALTY Ribosomal RNA small subunit methyltran... 30 4.7 sp|Q9MZV8|MC5R_PIG Melanocortin-5 receptor 29 8.0
>sp|P05085|ARGR2_YEAST Arginine metabolism regulation protein II Length = 880 Score = 32.7 bits (73), Expect = 0.73 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +2 Query: 320 QYAKPTQFQTYGQIFPKNNRPVFREINNVTRKPEATKGNIEPVSYG---IYHSPSYEEPV 490 +++KP QF YG P+N+ ++ +P+ + NI+ V Y +YH +E Sbjct: 56 RWSKPMQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELT 115 Query: 491 RINRFPPL 514 ++ PP+ Sbjct: 116 MLHT-PPI 122
>sp|O15027|K0310_HUMAN Protein KIAA0310 Length = 2179 Score = 32.7 bits (73), Expect = 0.73 Identities = 26/96 (27%), Positives = 36/96 (37%), Gaps = 14/96 (14%) Frame = +2 Query: 74 PMQFMPPPLYEIGSIWIPKLNHIDVYNSSGVDYCQGGWRKWNSAGHWDMHAMSSTAVEPD 253 P Q P Y S W + ++ Y SS DY GHWD + S+ +P Sbjct: 1056 PRQGYPEGYYSSKSGWSSQSDYYASYYSSQYDY--------GDPGHWDRYHYSARVRDPR 1107 Query: 254 WYHR-----------KREYIRGAD---QKVMNWHYD 319 Y R +RE+ D ++ NW YD Sbjct: 1108 TYDRRYWCDAEYDAYRREHSAFGDRPEKRDNNWRYD 1143
>sp|P24361|VF09_VACCV Protein F9 Length = 212 Score = 31.6 bits (70), Expect = 1.6 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -1 Query: 553 VPNKNVLFVFWIVQWRKPIYSNWFLIGWAMINPITNRFNIPLCCFR 416 V + N ++V I++ R P Y WFL+G A+I I F + +C R Sbjct: 155 VKSLNKIYVPPIIENRLPYYDPWFLVGVAIILVI---FTVAICSIR 197
>sp|P68453|VF09_VACCP Protein F9 sp|P68452|VF09_VACCC Protein F9 Length = 212 Score = 31.6 bits (70), Expect = 1.6 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -1 Query: 553 VPNKNVLFVFWIVQWRKPIYSNWFLIGWAMINPITNRFNIPLCCFR 416 V + N ++V I++ R P Y WFL+G A+I I F + +C R Sbjct: 155 VKSLNKIYVPPIIENRLPYYDPWFLVGVAIILVI---FTVAICSIR 197
>sp|P33869|VF09_VARV Protein F9 Length = 212 Score = 30.8 bits (68), Expect = 2.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 541 NVLFVFWIVQWRKPIYSNWFLIGWAMINPITNRFNIPLCCFR 416 N ++V I++ R P Y WFL+G A+I I F + +C R Sbjct: 159 NKIYVPPIIENRLPYYDPWFLVGVAIILVI---FTVAICSIR 197
>sp|P09152|NARG_ECOLI Respiratory nitrate reductase 1 alpha chain (Nitrate reductase A alpha subunit) (Quinol-nitrate oxidoreductase alpha subunit) Length = 1247 Score = 30.4 bits (67), Expect = 3.6 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +2 Query: 398 NNVTRKPEATKGNIEPVSYGIYHSPSYEEPVRINRFPPLHDPKHK*NIFIWYSNRL 565 N +T EA K + PV Y + E +R P + H N+FIW SN L Sbjct: 665 NPLTIAGEAEKAGMNPVDYTV--KSLKEGSIRFAAEQPENGKNHPRNLFIWRSNLL 718
>sp|Q8Z1X1|RSMB_SALTI Ribosomal RNA small subunit methyltransferase B (rRNA (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967 methyltransferase) Length = 429 Score = 30.4 bits (67), Expect = 3.6 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +2 Query: 320 QYAKPTQFQTYGQIFPKNNR--PVFREINNVTRKPEATKGNIEPVSYGIYHSPSYEEPVR 493 Q A PTQ+Q +I NN+ P++ +N + G +E Y P Y + VR Sbjct: 154 QNAYPTQWQ---RIIEANNQRPPMWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVR 210 Query: 494 INRFPPLH 517 + P+H Sbjct: 211 LETPAPVH 218
>sp|O97939|ENAM_PIG Enamelin precursor [Contains: 89 kDa enamelin; 142 kDa enamelin; 155 kDa enamelin; 56 kDa enamelin; 32 kDa enamelin; 25 kDa enamelin; 34 kDa enamelin] Length = 1142 Score = 30.4 bits (67), Expect = 3.6 Identities = 26/111 (23%), Positives = 42/111 (37%) Frame = +2 Query: 68 HYPMQFMPPPLYEIGSIWIPKLNHIDVYNSSGVDYCQGGWRKWNSAGHWDMHAMSSTAVE 247 HYPM P P I N D + +G ++ G R WDM +S Sbjct: 631 HYPMN-TPDPKETI------PYNEEDPIDPTGDEHFPGQSR-------WDMEELSFKEDP 676 Query: 248 PDWYHRKREYIRGADQKVMNWHYDQYAKPTQFQTYGQIFPKNNRPVFREIN 400 ++ +Y ++ + + D +KP + YG+ +P N F N Sbjct: 677 TVRHYEGEQYTSNQPKEYLPYSLDNPSKpreDFLYGEFYPWNPEENFPSYN 727
>sp|Q8ZLM5|RSMB_SALTY Ribosomal RNA small subunit methyltransferase B (rRNA (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967 methyltransferase) Length = 429 Score = 30.0 bits (66), Expect = 4.7 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +2 Query: 320 QYAKPTQFQTYGQIFPKNNR--PVFREINNVTRKPEATKGNIEPVSYGIYHSPSYEEPVR 493 Q A PTQ+Q I NN+ P++ +N + G +E Y P Y + VR Sbjct: 154 QNAYPTQWQ---HIIEANNQRPPMWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVR 210 Query: 494 INRFPPLH 517 + P+H Sbjct: 211 LETPAPVH 218
>sp|Q9MZV8|MC5R_PIG Melanocortin-5 receptor Length = 294 Score = 29.3 bits (64), Expect = 8.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 221 ACPSDLRCSIFASHLDNNLLHSNCKHLCDLV*ESIYYQFHKEEE 90 +CP +L CS F SH + L+ +C+ V + + Y F +E+ Sbjct: 255 SCPQNLYCSCFMSHFNMYLI----LIMCNSVIDPLIYAFRSQEK 294
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 80,800,562
Number of Sequences: 369166
Number of extensions: 1846219
Number of successful extensions: 4447
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 4341
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4446
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4650991475
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
