Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00025 (803 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q76LN2|NU5M_ROUAM NADH-ubiquinone oxidoreductase chain 5... 33 0.70 sp|Q58017|T2M3_METJA Type II restriction enzyme MjaIII (End... 31 4.5 sp|Q92BD8|YG12_LISIN Hypothetical UPF0173 metal-dependent h... 30 7.7
>sp|Q76LN2|NU5M_ROUAM NADH-ubiquinone oxidoreductase chain 5 (NADH dehydrogenase subunit 5) Length = 605 Score = 33.5 bits (75), Expect = 0.70 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 2 NSARG*FKMSPPSGKSFFSKLNGLIPTSAHHLRPIIAVL 118 N+A K++PPS FS L G PT H L+P+ ++L Sbjct: 505 NTATQNLKLTPPSNYLKFSNLLGYFPTIMHRLQPLTSLL 543
>sp|Q58017|T2M3_METJA Type II restriction enzyme MjaIII (Endonuclease MjaIII) (R.MjaIII) Length = 290 Score = 30.8 bits (68), Expect = 4.5 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = +2 Query: 143 LCVLSSGRHILYNPDIEVNRLESKAEKKISDFKL-----LFKDHDEEDLMPVRLLKNGGI 307 L + + + N ++E+ LE K +K ++D ++ FK+ EDL+ R +KN Sbjct: 70 LIAVRDNKITILNENMELETLEFKEKKYLTDEEIERYYKFFKETGLEDLLKNRKIKNLVD 129 Query: 308 RIYGVNDGQEEAA 346 ++GV G + A Sbjct: 130 YVFGVEVGMDTNA 142
>sp|Q92BD8|YG12_LISIN Hypothetical UPF0173 metal-dependent hydrolase lin1612 Length = 228 Score = 30.0 bits (66), Expect = 7.7 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +2 Query: 149 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 313 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGNTTILVDPFISGNEKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 314 -----YGVNDGQEEAA 346 V DG E A Sbjct: 73 DLASFLAVEDGLENIA 88
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,128,337
Number of Sequences: 369166
Number of extensions: 1210426
Number of successful extensions: 2712
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2640
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2710
length of database: 68,354,980
effective HSP length: 109
effective length of database: 48,218,865
effective search space used: 7618580670
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)