Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_010_P06 (775 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58017|T2M3_METJA Type II restriction enzyme MjaIII (End... 31 4.3 sp|Q92BD8|YG12_LISIN Hypothetical UPF0173 metal-dependent h... 30 7.3 sp|Q8R4H4|CBPA5_MOUSE Carboxypeptidase A5 precursor 30 9.5 sp|Q8Y6V4|YF77_LISMO Hypothetical UPF0173 metal-dependent h... 30 9.5 sp|Q71Z90|Y1599_LISMF Hypothetical UPF0173 metal-dependent ... 30 9.5
>sp|Q58017|T2M3_METJA Type II restriction enzyme MjaIII (Endonuclease MjaIII) (R.MjaIII) Length = 290 Score = 30.8 bits (68), Expect = 4.3 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = +3 Query: 117 LCVLSSGRHILYNPDIEVNRLESKAEKKISDFKL-----LFKDHDEEDLMPVRLLKNGGI 281 L + + + N ++E+ LE K +K ++D ++ FK+ EDL+ R +KN Sbjct: 70 LIAVRDNKITILNENMELETLEFKEKKYLTDEEIERYYKFFKETGLEDLLKNRKIKNLVD 129 Query: 282 RIYGVNDGQEEAA 320 ++GV G + A Sbjct: 130 YVFGVEVGMDTNA 142
>sp|Q92BD8|YG12_LISIN Hypothetical UPF0173 metal-dependent hydrolase lin1612 Length = 228 Score = 30.0 bits (66), Expect = 7.3 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 123 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 287 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGNTTILVDPFISGNEKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 288 -----YGVNDGQEEAA 320 V DG E A Sbjct: 73 DLASFLAVEDGLENIA 88
>sp|Q8R4H4|CBPA5_MOUSE Carboxypeptidase A5 precursor Length = 436 Score = 29.6 bits (65), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 765 NFIKNIPNSIQKLHLLKHFSNECVVVFEFSS 673 NF+ N + K+H+ K F N ++V +FS+ Sbjct: 151 NFVAEHSNLVSKIHIGKSFENRSILVLKFST 181
>sp|Q8Y6V4|YF77_LISMO Hypothetical UPF0173 metal-dependent hydrolase lmo1577 Length = 228 Score = 29.6 bits (65), Expect = 9.5 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 123 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 287 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGDTTILVDPFISGNEKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 288 -----YGVNDGQEEAA 320 V DG E A Sbjct: 73 DLASFLAVEDGLENMA 88
>sp|Q71Z90|Y1599_LISMF Hypothetical UPF0173 metal-dependent hydrolase LMOf2365_1599 Length = 228 Score = 29.6 bits (65), Expect = 9.5 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 123 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 287 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGDTTILVDPFISGNDKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 288 -----YGVNDGQEEAA 320 V DG E A Sbjct: 73 DLASFLAVEDGLENIA 88
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,299,002 Number of Sequences: 369166 Number of extensions: 1146348 Number of successful extensions: 2561 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2559 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 7212136400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)