Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_J13 (406 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58017|T2M3_METJA Type II restriction enzyme MjaIII (End... 31 1.1 sp|Q92BD8|YG12_LISIN Hypothetical UPF0173 metal-dependent h... 30 1.8 sp|Q8Y6V4|YF77_LISMO Hypothetical UPF0173 metal-dependent h... 30 2.4 sp|Q71Z90|Y1599_LISMF Hypothetical UPF0173 metal-dependent ... 30 2.4 sp|P10822|ICW3_PSOTE Chymotrypsin inhibitor 3 precursor (WC... 28 7.0 sp|Q72CF4|RPOA_DESVH DNA-directed RNA polymerase alpha chai... 28 7.0 sp|Q09796|YAA2_SCHPO Hypothetical protein C22G7.02 in chrom... 28 9.1
>sp|Q58017|T2M3_METJA Type II restriction enzyme MjaIII (Endonuclease MjaIII) (R.MjaIII) Length = 290 Score = 30.8 bits (68), Expect = 1.1 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = +3 Query: 72 LCVLSSGRHILYNPDIEVNRLESKAEKKISDFKL-----LFKDHDEEDLMPVRLLKNGGI 236 L + + + N ++E+ LE K +K ++D ++ FK+ EDL+ R +KN Sbjct: 70 LIAVRDNKITILNENMELETLEFKEKKYLTDEEIERYYKFFKETGLEDLLKNRKIKNLVD 129 Query: 237 RIYGVNDGQEEAA 275 ++GV G + A Sbjct: 130 YVFGVEVGMDTNA 142
>sp|Q92BD8|YG12_LISIN Hypothetical UPF0173 metal-dependent hydrolase lin1612 Length = 228 Score = 30.0 bits (66), Expect = 1.8 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 78 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 242 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGNTTILVDPFISGNEKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 243 -----YGVNDGQEEAA 275 V DG E A Sbjct: 73 DLASFLAVEDGLENIA 88
>sp|Q8Y6V4|YF77_LISMO Hypothetical UPF0173 metal-dependent hydrolase lmo1577 Length = 228 Score = 29.6 bits (65), Expect = 2.4 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 78 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 242 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGDTTILVDPFISGNEKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 243 -----YGVNDGQEEAA 275 V DG E A Sbjct: 73 DLASFLAVEDGLENMA 88
>sp|Q71Z90|Y1599_LISMF Hypothetical UPF0173 metal-dependent hydrolase LMOf2365_1599 Length = 228 Score = 29.6 bits (65), Expect = 2.4 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%) Frame = +3 Query: 78 VLSSGRHILYNPDIEVN-RLESKAEKKISDFKLLFKDHDEEDLMPVRLLKNGGIRI---- 242 +++ IL +P I N + + KAE+++ DF +L HD+ V + KN G + Sbjct: 13 IITGDTTILVDPFISGNDKCDLKAEEQMPDFIVLSHGHDDHVGDTVEIAKNSGATVICNA 72 Query: 243 -----YGVNDGQEEAA 275 V DG E A Sbjct: 73 DLASFLAVEDGLENIA 88
>sp|P10822|ICW3_PSOTE Chymotrypsin inhibitor 3 precursor (WCI-3) Length = 207 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 114 DIEVNRLESKAEKKISDFKLLFKDHDEEDL 203 DI V + E + I +KLL+ HDEED+ Sbjct: 137 DILVFKFEKVSHSNIHVYKLLYCQHDEEDV 166
>sp|Q72CF4|RPOA_DESVH DNA-directed RNA polymerase alpha chain (RNAP alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 347 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 226 TEELEYMELMMDKRRQLLNID*LSNSEIRVIN 321 TEE +Y+EL +DKR + D +N + V+N Sbjct: 106 TEEPQYLELKVDKRGAITAGDVRTNQHVMVLN 137
>sp|Q09796|YAA2_SCHPO Hypothetical protein C22G7.02 in chromosome I Length = 990 Score = 27.7 bits (60), Expect = 9.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 165 SQISSFLLCFLSDLPQYLDCTKYVYQN*VHIMKHQLHKKIVRQL 34 SQ+ S CFL + PQYL+ + V + +HI + + + R + Sbjct: 532 SQLLSSCSCFLQNHPQYLNISLPVLFDALHISETSIQMTVSRSI 575
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,942,063 Number of Sequences: 369166 Number of extensions: 551621 Number of successful extensions: 1339 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1337 length of database: 68,354,980 effective HSP length: 98 effective length of database: 50,250,950 effective search space used: 1809034200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)