Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01104 (326 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P00407|COX2_XENLA Cytochrome c oxidase subunit 2 (Cytoch... 34 0.12 sp|O47672|COX2_DUSTH Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|Q96183|COX2_POLOR Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|O47673|COX2_VULZE Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|P98025|COX2_CHOBI Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|O47681|COX2_VULVU Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|O47680|COX2_VULMA Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|Q7J6G2|COX2_PSEVE Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|P67782|COX2_CANLU Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|O47669|COX2_CANAU Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34
>sp|P00407|COX2_XENLA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 229 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/61 (22%), Positives = 30/61 (49%) Frame = +1 Query: 142 EKSLMLRLMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFY 321 E ++ +MP + +++ L ++ E+N+PHL + W E N++ ++F Sbjct: 60 EIEMVWTIMPAISLIMIALPSLRILYLMDEVNDPHLTIKAIGHQWYWSYEYTNYEDLSFD 119 Query: 322 S 324 S Sbjct: 120 S 120
>sp|O47672|COX2_DUSTH Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + VL+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILVLIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|Q96183|COX2_POLOR Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 230 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +1 Query: 142 EKSLMLRLMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFY 321 E ++ +MP L + + L ++ EIN+PHL + W E ++ ++NF Sbjct: 60 EIEIVWTVMPALVLIAIALPSLRILYLMDEINDPHLTIKATGHQWYWSYEYTDYDTLNFD 119 Query: 322 S 324 S Sbjct: 120 S 120
>sp|O47673|COX2_VULZE Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + VL+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILVLIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|P98025|COX2_CHOBI Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +1 Query: 151 LMLRLMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 L+ ++PT+ + + L +L E+NNP + + + W E +FQ+I F S Sbjct: 63 LIWTILPTITLIFIALPSLRLLYLLDELNNPLITLKSIGHQWYWSYEYSDFQNIQFDS 120
>sp|O47681|COX2_VULVU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|O47680|COX2_VULMA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|Q7J6G2|COX2_PSEVE Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|P67782|COX2_CANLU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) sp|P67781|COX2_CANLA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) sp|P67780|COX2_CANFA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|O47669|COX2_CANAU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 163 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 324 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,439,795
Number of Sequences: 369166
Number of extensions: 561812
Number of successful extensions: 1708
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1683
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1706
length of database: 68,354,980
effective HSP length: 77
effective length of database: 54,130,385
effective search space used: 1678041935
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)