Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_015_D16 (300 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P00407|COX2_XENLA Cytochrome c oxidase subunit 2 (Cytoch... 34 0.12 sp|O47672|COX2_DUSTH Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|Q96183|COX2_POLOR Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|O47673|COX2_VULZE Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|P98025|COX2_CHOBI Cytochrome c oxidase subunit 2 (Cytoch... 33 0.26 sp|O47681|COX2_VULVU Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|O47680|COX2_VULMA Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|Q7J6G2|COX2_PSEVE Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|P67782|COX2_CANLU Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34 sp|O47669|COX2_CANAU Cytochrome c oxidase subunit 2 (Cytoch... 32 0.34
>sp|P00407|COX2_XENLA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 229 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/61 (22%), Positives = 30/61 (49%) Frame = +2 Query: 116 EKSLMLRLMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFY 295 E ++ +MP + +++ L ++ E+N+PHL + W E N++ ++F Sbjct: 60 EIEMVWTIMPAISLIMIALPSLRILYLMDEVNDPHLTIKAIGHQWYWSYEYTNYEDLSFD 119 Query: 296 S 298 S Sbjct: 120 S 120
>sp|O47672|COX2_DUSTH Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + VL+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILVLIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|Q96183|COX2_POLOR Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 230 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +2 Query: 116 EKSLMLRLMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFY 295 E ++ +MP L + + L ++ EIN+PHL + W E ++ ++NF Sbjct: 60 EIEIVWTVMPALVLIAIALPSLRILYLMDEINDPHLTIKATGHQWYWSYEYTDYDTLNFD 119 Query: 296 S 298 S Sbjct: 120 S 120
>sp|O47673|COX2_VULZE Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + VL+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILVLIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|P98025|COX2_CHOBI Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.7 bits (73), Expect = 0.26 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +2 Query: 125 LMLRLMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 L+ ++PT+ + + L +L E+NNP + + + W E +FQ+I F S Sbjct: 63 LIWTILPTITLIFIALPSLRLLYLLDELNNPLITLKSIGHQWYWSYEYSDFQNIQFDS 120
>sp|O47681|COX2_VULVU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|O47680|COX2_VULMA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|Q7J6G2|COX2_PSEVE Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|P67782|COX2_CANLU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) sp|P67781|COX2_CANLA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) sp|P67780|COX2_CANFA Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
>sp|O47669|COX2_CANAU Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) Length = 227 Score = 32.3 bits (72), Expect = 0.34 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 137 LMPTLKFVLVRYVQPATLMVLMEINNPHLVVSNWHQN*SWKEENKNFQSINFYS 298 ++P + +L+ L ++ EINNP L V W E +++ +NF S Sbjct: 67 ILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS 120
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,843,971 Number of Sequences: 369166 Number of extensions: 508136 Number of successful extensions: 1583 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1581 length of database: 68,354,980 effective HSP length: 69 effective length of database: 55,608,265 effective search space used: 1668247950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)