Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01095 (1124 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Y6U3|ADSV_HUMAN Adseverin (Scinderin) 31 5.7
>sp|Q9Y6U3|ADSV_HUMAN Adseverin (Scinderin) Length = 715 Score = 31.2 bits (69), Expect = 5.7 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +3 Query: 84 KSNQYSTNRVHKQRKGKNYILMVENNIPLTRIVNTIGETLEL 209 K+NQ +T + +RKG++ +++VE + ++ +GE EL Sbjct: 189 KANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPEL 230
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 120,526,792
Number of Sequences: 369166
Number of extensions: 2373869
Number of successful extensions: 4793
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4618
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4792
length of database: 68,354,980
effective HSP length: 112
effective length of database: 47,664,660
effective search space used: 12488140920
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)