DrC_01016
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01016 (619 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53073|YGY1_YEAST Hypothetical 21.5 kDa protein in SEC15... 80 5e-15 sp|P57292|PANC_BUCAI Pantoate--beta-alanine ligase (Pantoth... 31 2.9 sp|O51314|RL13_BORBU 50S ribosomal protein L13 30 6.5 sp|P00548|KPYK_CHICK Pyruvate kinase, muscle isozyme 29 8.5 sp|Q5ZKK1|MARE2_CHICK Microtubule-associated protein RP/EB ... 29 8.5
>sp|P53073|YGY1_YEAST Hypothetical 21.5 kDa protein in SEC15-SAP4 intergenic region Length = 190 Score = 79.7 bits (195), Expect = 5e-15 Identities = 46/144 (31%), Positives = 72/144 (50%), Gaps = 20/144 (13%) Frame = +2 Query: 131 LPSPVGYSDRSLPSSSVRKNDSD---------------LMVKRSWDIALGPIKQIPMNLI 265 LPSP G+ S + RK L V+++W IAL P K IPMN+ Sbjct: 30 LPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITVLQVQKAWQIALQPAKSIPMNIF 89 Query: 266 LMWMAGNTISIFPIVMVFMMFLRPIQAIFSMQSTFQVIEGSAAS-----IQCFVYFLGNV 430 + +M+G ++ I PI+ M+ PI+AIFS +S F+ + G+ A+ F+Y + Sbjct: 90 MSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPVLGNKATQSQVQTAMFMYIVFQG 149 Query: 431 LNLGLAVYKCHIMGLLPTFASDWL 502 + + + K + MGL+P DWL Sbjct: 150 VLMYIGYRKLNSMGLIPNAKGDWL 173
>sp|P57292|PANC_BUCAI Pantoate--beta-alanine ligase (Pantothenate synthetase) (Pantoate-activating enzyme) Length = 285 Score = 30.8 bits (68), Expect = 2.9 Identities = 18/80 (22%), Positives = 41/80 (51%) Frame = -3 Query: 605 VLKRKINILNY*MKIITLKFLQLTTRLS*EVQQKPTNLRQRWVIDPLYDIYTQLILSLIH 426 ++K + LNY +KII+L ++L L+ + + ++ + LY I + +I Sbjct: 158 IIKILVKELNYMIKIISLPTIRLKNGLALSSRNNYLSSQENEIAPYLYKIIKKTCEKIIK 217 Query: 425 YQENIQSIVLTQQNLLSLEK 366 +NI+ ++ + +L ++K Sbjct: 218 EDDNIRPKIIHESKILLIKK 237
>sp|O51314|RL13_BORBU 50S ribosomal protein L13 Length = 146 Score = 29.6 bits (65), Expect = 6.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 48 YQKLRENGILISVAKVKQTDHNYHHRLIYLH 140 +Q L +N I+I+ +KVK T Y +L Y H Sbjct: 53 HQDLGDNVIIINASKVKLTGKKYQQKLYYRH 83
>sp|P00548|KPYK_CHICK Pyruvate kinase, muscle isozyme Length = 530 Score = 29.3 bits (64), Expect = 8.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 363 DCMENIAWIGRKNIIKTITMGN 298 +C EN+ W+ KN+IK I +G+ Sbjct: 150 NCDENVLWVDYKNLIKVIDVGS 171
>sp|Q5ZKK1|MARE2_CHICK Microtubule-associated protein RP/EB family member 2 Length = 338 Score = 29.3 bits (64), Expect = 8.5 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +2 Query: 35 QPVDISKASRKWNFDFSGKSKADRSQLSSPVDLPSPVGYSDRSLPSSSVRKNDSDL 202 Q ++ K S N +G +K+ S S P PS + ++ PSSS K+D DL Sbjct: 187 QIFNLPKKSHHANSPTAGAAKS--SPASKPGSTPSRPSSAKKAAPSSSASKSDKDL 240
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 75,429,755
Number of Sequences: 369166
Number of extensions: 1613794
Number of successful extensions: 4165
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 4030
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4158
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4895780500
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
