Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_G19 (582 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53073|YGY1_YEAST Hypothetical 21.5 kDa protein in SEC15... 80 5e-15 sp|P57292|PANC_BUCAI Pantoate--beta-alanine ligase (Pantoth... 31 2.6 sp|O51314|RL13_BORBU 50S ribosomal protein L13 30 5.7 sp|P00548|KPYK_CHICK Pyruvate kinase, muscle isozyme 29 7.4 sp|Q5ZKK1|MARE2_CHICK Microtubule-associated protein RP/EB ... 29 9.7 sp|P16453|DCHS_RAT Histidine decarboxylase (HDC) 29 9.7 sp|Q9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (M... 29 9.7
>sp|P53073|YGY1_YEAST Hypothetical 21.5 kDa protein in SEC15-SAP4 intergenic region Length = 190 Score = 79.7 bits (195), Expect = 5e-15 Identities = 46/144 (31%), Positives = 72/144 (50%), Gaps = 20/144 (13%) Frame = +1 Query: 94 LPSPVGYSDRSLPSSSVRKNDSD---------------LMVKRSWDIALGPIKQIPMNLI 228 LPSP G+ S + RK L V+++W IAL P K IPMN+ Sbjct: 30 LPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITVLQVQKAWQIALQPAKSIPMNIF 89 Query: 229 LMWMAGNTISIFPIVMVFMMFLRPIQAIFSMQSTFQVIEGSAAS-----IQCFVYFLGNV 393 + +M+G ++ I PI+ M+ PI+AIFS +S F+ + G+ A+ F+Y + Sbjct: 90 MSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPVLGNKATQSQVQTAMFMYIVFQG 149 Query: 394 LNLGLAVYKCHIMGLLPTFASDWL 465 + + + K + MGL+P DWL Sbjct: 150 VLMYIGYRKLNSMGLIPNAKGDWL 173
>sp|P57292|PANC_BUCAI Pantoate--beta-alanine ligase (Pantothenate synthetase) (Pantoate-activating enzyme) Length = 285 Score = 30.8 bits (68), Expect = 2.6 Identities = 18/80 (22%), Positives = 41/80 (51%) Frame = -3 Query: 568 VLKRKINILNY*MKIITLKFLQLTTRLS*EVQQKPTNLRQRWVIDPLYDIYTQLILSLIH 389 ++K + LNY +KII+L ++L L+ + + ++ + LY I + +I Sbjct: 158 IIKILVKELNYMIKIISLPTIRLKNGLALSSRNNYLSSQENEIAPYLYKIIKKTCEKIIK 217 Query: 388 YQENIQSIVLTQQNLLSLEK 329 +NI+ ++ + +L ++K Sbjct: 218 EDDNIRPKIIHESKILLIKK 237
>sp|O51314|RL13_BORBU 50S ribosomal protein L13 Length = 146 Score = 29.6 bits (65), Expect = 5.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 11 YQKLRENGILISVAKVKQTDHNYHHRLIYLH 103 +Q L +N I+I+ +KVK T Y +L Y H Sbjct: 53 HQDLGDNVIIINASKVKLTGKKYQQKLYYRH 83
>sp|P00548|KPYK_CHICK Pyruvate kinase, muscle isozyme Length = 530 Score = 29.3 bits (64), Expect = 7.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 326 DCMENIAWIGRKNIIKTITMGN 261 +C EN+ W+ KN+IK I +G+ Sbjct: 150 NCDENVLWVDYKNLIKVIDVGS 171
>sp|Q5ZKK1|MARE2_CHICK Microtubule-associated protein RP/EB family member 2 Length = 338 Score = 28.9 bits (63), Expect = 9.7 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = +1 Query: 7 DISKASRKWNFDFSGKSKADRSQLSSPVDLPSPVGYSDRSLPSSSVRKNDSDL 165 ++ K S N +G +K+ S S P PS + ++ PSSS K+D DL Sbjct: 190 NLPKKSHHANSPTAGAAKS--SPASKPGSTPSRPSSAKKAAPSSSASKSDKDL 240
>sp|P16453|DCHS_RAT Histidine decarboxylase (HDC) Length = 656 Score = 28.9 bits (63), Expect = 9.7 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 109 GYSDRSLPSSSVRKNDSDLMVKRSWDIALGPIKQIPMNLILMWMAGNTISIFP 267 GY +PSS+ + DS WD G I+QI M ++ W + + + +P Sbjct: 40 GYLRAQIPSSAPEEPDS-------WDSIFGDIEQIIMPGVVHWQSPHMHAYYP 85
>sp|Q9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (Methyl-CpG binding protein MBD1) (Protein containing methyl-CpG-binding domain 1) Length = 605 Score = 28.9 bits (63), Expect = 9.7 Identities = 19/70 (27%), Positives = 29/70 (41%) Frame = +1 Query: 67 RSQLSSPVDLPSPVGYSDRSLPSSSVRKNDSDLMVKRSWDIALGPIKQIPMNLILMWMAG 246 R SSPV +P PV S +L + SW +AL +KQ + W G Sbjct: 460 REGASSPVQVPGPVAASTEALLQEAQCSG-------LSWVVALPQVKQEKADTQDEWTPG 512 Query: 247 NTISIFPIVM 276 + P+++ Sbjct: 513 TAVLTSPVLV 522
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,024,317 Number of Sequences: 369166 Number of extensions: 1512636 Number of successful extensions: 3852 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3845 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4308286840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)