Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00981 (408 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZUP0|LBD8_ARATH Putative LOB domain protein 8 28 5.5 sp|Q89AT4|NUON_BUCBP NADH-quinone oxidoreductase chain N (N... 28 5.5
>sp|Q9ZUP0|LBD8_ARATH Putative LOB domain protein 8 Length = 120 Score = 28.5 bits (62), Expect = 5.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 12 CEPYNAYIPYELLDYYEPQNSFFTTRSGMECRRY 113 CE Y Y PYEL +YE N F T ++ R+ Sbjct: 24 CE-YAEYFPYELRSHYESTNELFGTPKIIKMMRH 56
>sp|Q89AT4|NUON_BUCBP NADH-quinone oxidoreductase chain N (NADH dehydrogenase I, chain N) (NDH-1, chain N) Length = 494 Score = 28.5 bits (62), Expect = 5.5 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -1 Query: 366 IFRNLIFNITKLKVFFILDVLLS--LDQEFLLYCSFDEIYLEPFHQ*FLLLLLCKV 205 I +F+I K + +I V++S L F YCS YL F + +LLLL C + Sbjct: 61 IHATTLFHIDKYSLLYIGIVIISSFLACIFSHYCSLTN-YLYNFEEFYLLLLFCTI 115
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,506,593
Number of Sequences: 369166
Number of extensions: 827984
Number of successful extensions: 2216
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2216
length of database: 68,354,980
effective HSP length: 98
effective length of database: 50,250,950
effective search space used: 1859285150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)