Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_L20 (362 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZUP0|LBD8_ARATH Putative LOB domain protein 8 28 5.1 sp|Q89AT4|NUON_BUCBP NADH-quinone oxidoreductase chain N (N... 28 6.6
>sp|Q9ZUP0|LBD8_ARATH Putative LOB domain protein 8 Length = 120 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 12 CEPYNAYIPYELLDYYEPQNSFFTTRSGMECRRY 113 CE Y Y PYEL +YE N F T ++ R+ Sbjct: 24 CE-YAEYFPYELRSHYESTNELFGTPKIIKMMRH 56
>sp|Q89AT4|NUON_BUCBP NADH-quinone oxidoreductase chain N (NADH dehydrogenase I, chain N) (NDH-1, chain N) Length = 494 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -3 Query: 351 IFNITKLKVFFILDVLLS--LDQEFLLYCSFDEIYLEPFHQ*FLLLLLCKV 205 +F+I K + +I V++S L F YCS YL F + +LLLL C + Sbjct: 66 LFHIDKYSLLYIGIVIISSFLACIFSHYCSLTN-YLYNFEEFYLLLLFCTI 115
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,469,576 Number of Sequences: 369166 Number of extensions: 765191 Number of successful extensions: 2029 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2029 length of database: 68,354,980 effective HSP length: 87 effective length of database: 52,283,035 effective search space used: 1725340155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)