DrC_00698
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00698 (509 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P43024|CX6A1_MOUSE Cytochrome c oxidase polypeptide VIa-... 33 0.30 sp|Q45479|LSPA_BACSU Lipoprotein signal peptidase (Prolipop... 30 3.3 sp|P32799|COX13_YEAST Cytochrome c oxidase polypeptide VIa,... 28 9.6 sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium chan... 28 9.6 sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium chan... 28 9.6 sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channe... 28 9.6 sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium chan... 28 9.6
>sp|P43024|CX6A1_MOUSE Cytochrome c oxidase polypeptide VIa-liver, mitochondrial precursor Length = 111 Score = 33.5 bits (75), Expect = 0.30 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 4/99 (4%) Frame = +1 Query: 25 AVMIINKKLRPEGNLWNGAF--YNTGFNANYRTGKMWFYLT-FLTFPIIGVFHYIAXXXX 195 AV+ ++ RP G G ++G + + +MW LT F+ P +GV + Sbjct: 4 AVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGV----SMLNV 59 Query: 196 XXXXXXXXXXXPPVPKYEWCKTYT-PFPWGDGQKPLFEH 309 PP Y + T PFPWGDG LF + Sbjct: 60 FLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHN 98
>sp|Q45479|LSPA_BACSU Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) Length = 154 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 88 NTGFNANYRTGKMWFYLTFLTFPIIGVFHYI 180 NTG G+MWF+ T IIG+ +YI Sbjct: 45 NTGAAWGILAGQMWFFYLITTAVIIGIVYYI 75
>sp|P32799|COX13_YEAST Cytochrome c oxidase polypeptide VIa, mitochondrial precursor Length = 129 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 7/30 (23%) Frame = +1 Query: 235 VPKYEWCKTYT-------PFPWGDGQKPLF 303 VP EW + Y PF WGDG K LF Sbjct: 87 VPDSEWPRDYEFMNIRSKPFFWGDGDKTLF 116
>sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2336 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2327 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 59,626,740
Number of Sequences: 369166
Number of extensions: 1212603
Number of successful extensions: 2493
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 2470
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2493
length of database: 68,354,980
effective HSP length: 103
effective length of database: 49,327,275
effective search space used: 3255600150
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
