Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_018_E10 (460 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P43024|CX6A1_MOUSE Cytochrome c oxidase polypeptide VIa-... 33 0.23 sp|Q45479|LSPA_BACSU Lipoprotein signal peptidase (Prolipop... 30 2.6 sp|P32799|COX13_YEAST Cytochrome c oxidase polypeptide VIa,... 28 7.5 sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium chan... 28 7.5 sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium chan... 28 7.5 sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channe... 28 7.5 sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium chan... 28 7.5 sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium chan... 28 9.8 sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channe... 28 9.8 sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium chan... 28 9.8
>sp|P43024|CX6A1_MOUSE Cytochrome c oxidase polypeptide VIa-liver, mitochondrial precursor Length = 111 Score = 33.5 bits (75), Expect = 0.23 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 4/99 (4%) Frame = +1 Query: 25 AVMIINKKLRPEGNLWNGAF--YNTGFNANYRTGKMWFYLT-FLTFPIIGVFHYIAXXXX 195 AV+ ++ RP G G ++G + + +MW LT F+ P +GV + Sbjct: 4 AVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGV----SMLNV 59 Query: 196 XXXXXXXXXXXPPVPKYEWCKTYT-PFPWGDGQKPLFEH 309 PP Y + T PFPWGDG LF + Sbjct: 60 FLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHN 98
>sp|Q45479|LSPA_BACSU Lipoprotein signal peptidase (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) Length = 154 Score = 30.0 bits (66), Expect = 2.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 88 NTGFNANYRTGKMWFYLTFLTFPIIGVFHYI 180 NTG G+MWF+ T IIG+ +YI Sbjct: 45 NTGAAWGILAGQMWFFYLITTAVIIGIVYYI 75
>sp|P32799|COX13_YEAST Cytochrome c oxidase polypeptide VIa, mitochondrial precursor Length = 129 Score = 28.5 bits (62), Expect = 7.5 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 7/30 (23%) Frame = +1 Query: 235 VPKYEWCKTYT-------PFPWGDGQKPLF 303 VP EW + Y PF WGDG K LF Sbjct: 87 VPDSEWPRDYEFMNIRSKPFFWGDGDKTLF 116
>sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 28.5 bits (62), Expect = 7.5 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 28.5 bits (62), Expect = 7.5 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2336 Score = 28.5 bits (62), Expect = 7.5 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel alpha-1B subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2327 Score = 28.5 bits (62), Expect = 7.5 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++A++ + + + EG W YNT N G W +L F+ IIG F Sbjct: 300 ILFAILTVFQCITMEG--WTDILYNT----NDAAGNTWNWLYFIPLIIIGSF 345
>sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel alpha-1E subunit (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2272 Score = 28.1 bits (61), Expect = 9.8 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++AV+ + + + EG W YNT N G W +L F+ IIG F Sbjct: 296 ILFAVLTVFQCITMEG--WTTVLYNT----NDALGATWNWLYFIPLIIIGSF 341
>sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel alpha-1E subunit (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (RBE-II) (RBE2) (Brain calcium channel II) (BII) Length = 2222 Score = 28.1 bits (61), Expect = 9.8 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++AV+ + + + EG W YNT N G W +L F+ IIG F Sbjct: 246 ILFAVLTVFQCITMEG--WTTVLYNT----NDALGATWNWLYFIPLIIIGSF 291
>sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel alpha-1E subunit (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2259 Score = 28.1 bits (61), Expect = 9.8 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 16 LVYAVMIINKKLRPEGNLWNGAFYNTGFNANYRTGKMWFYLTFLTFPIIGVF 171 +++AV+ + + + EG W YNT N G W +L F+ IIG F Sbjct: 295 ILFAVLTVFQCITMEG--WTTVLYNT----NDALGATWNWLYFIPLIIIGSF 340
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,076,609 Number of Sequences: 369166 Number of extensions: 1121703 Number of successful extensions: 2356 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2356 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2534533995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)