Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00594 (614 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Y6H1|CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix d... 48 2e-05 sp|Q9D1L0|CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix d... 42 0.002 sp|Q09254|YQ5B_CAEEL Hypothetical protein C16C10.11 in chro... 38 0.018
>sp|Q9Y6H1|CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing protein 2 (HCV NS2 trans-regulated protein) (NS2TP) Length = 151 Score = 47.8 bits (112), Expect = 2e-05 Identities = 29/99 (29%), Positives = 38/99 (38%) Frame = +3 Query: 114 GMFAQMXXXXXXXXXXXXXXXXXXXXLTGGMSGGHNSDXXXXXXXXXXPSYGYXXXXXXX 293 G+ AQM +TGG SGG N++ P G Sbjct: 54 GLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQ-GTQPAQQQQ 112 Query: 294 XXXXXXXELLRCTQNESDISLCMGFSEALKDCKRFYGLS 410 + L C QN+ DI LC GF+E LK C+ GL+ Sbjct: 113 PCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA 151
>sp|Q9D1L0|CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing protein 2 Length = 153 Score = 41.6 bits (96), Expect = 0.002 Identities = 26/99 (26%), Positives = 37/99 (37%), Gaps = 1/99 (1%) Frame = +3 Query: 114 GMFAQMXXXXXXXXXXXXXXXXXXXXLTGGMSGGHNSDXXXXXXXXXXPSYGYXXXXXXX 293 G+ AQM +TGG SGG +++ P Sbjct: 54 GLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITYQEPQGAQLQNQQSF 113 Query: 294 XXXXXXX-ELLRCTQNESDISLCMGFSEALKDCKRFYGL 407 + L C QN+SD+ LC GF+E L+ C+ GL Sbjct: 114 GPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCRIANGL 152
>sp|Q09254|YQ5B_CAEEL Hypothetical protein C16C10.11 in chromosome III Length = 154 Score = 38.1 bits (87), Expect = 0.018 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +3 Query: 315 ELLRCTQNESDISLCMGFSEALKDCKRFY 401 + + C QN+SD+SLC GF++ K CK Y Sbjct: 125 QFVDCAQNQSDVSLCNGFNDIFKQCKARY 153
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 46,714,985
Number of Sequences: 369166
Number of extensions: 635370
Number of successful extensions: 971
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 956
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 970
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4846822695
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)