Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_027_J09 (457 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Y6H1|CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix d... 46 4e-05 sp|Q9D1L0|CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix d... 40 0.002 sp|Q09254|YQ5B_CAEEL Hypothetical protein C16C10.11 in chro... 38 0.009
>sp|Q9Y6H1|CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing protein 2 (HCV NS2 trans-regulated protein) (NS2TP) Length = 151 Score = 45.8 bits (107), Expect = 4e-05 Identities = 27/93 (29%), Positives = 35/93 (37%) Frame = +2 Query: 107 GMFAQMXXXXXXXXXXXXXXXXXXXXLTGGMSGGHNSDXXXXXXXXXXPSYGYXXXXXXX 286 G+ AQM +TGG SGG N++ P G Sbjct: 54 GLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQ-GTQPAQQQQ 112 Query: 287 XXXXXXXELLRCTQNESDISLCMGFSEALKDCK 385 + L C QN+ DI LC GF+E LK C+ Sbjct: 113 PCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR 145
>sp|Q9D1L0|CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing protein 2 Length = 153 Score = 40.4 bits (93), Expect = 0.002 Identities = 24/94 (25%), Positives = 35/94 (37%), Gaps = 1/94 (1%) Frame = +2 Query: 107 GMFAQMXXXXXXXXXXXXXXXXXXXXLTGGMSGGHNSDXXXXXXXXXXPSYGYXXXXXXX 286 G+ AQM +TGG SGG +++ P Sbjct: 54 GLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITYQEPQGAQLQNQQSF 113 Query: 287 XXXXXXX-ELLRCTQNESDISLCMGFSEALKDCK 385 + L C QN+SD+ LC GF+E L+ C+ Sbjct: 114 GPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCR 147
>sp|Q09254|YQ5B_CAEEL Hypothetical protein C16C10.11 in chromosome III Length = 154 Score = 38.1 bits (87), Expect = 0.009 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 308 ELLRCTQNESDISLCMGFSEALKDCKRFY 394 + + C QN+SD+SLC GF++ K CK Y Sbjct: 125 QFVDCAQNQSDVSLCNGFNDIFKQCKARY 153
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,078,087 Number of Sequences: 369166 Number of extensions: 448566 Number of successful extensions: 832 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2484837250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)