Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00508 (579 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15... 67 2e-11 sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15... 59 1e-08 sp|P26371|KRA59_HUMAN Keratin-associated protein 5-9 (Kerat... 34 0.23 sp|O27719|YG84_METTH Hypothetical protein MTH1684 32 1.5 sp|P23327|SRCH_HUMAN Sarcoplasmic reticulum histidine-rich ... 31 2.5 sp|Q92800|EZH1_HUMAN Enhancer of zeste homolog 1 (ENX-2) 30 3.3 sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-rich ... 30 3.3 sp|Q6L8G5|KR510_HUMAN Keratin-associated protein 5-10 (Kera... 30 3.3 sp|P70351|EZH1_MOUSE Enhancer of zeste homolog 1 (ENX-2) 30 3.3 sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protei... 30 4.3
>sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15 protein) Length = 115 Score = 67.4 bits (163), Expect = 2e-11 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 1/94 (1%) Frame = +1 Query: 13 AEWQHGLCGCCSDCGTCLLSYLC-PCYLVGKDAEAVGDSCFLCGLSYCIIPPCIGALIRK 189 + WQ G+C C SDCG CL C PC +G A + C LCG S +R Sbjct: 24 SNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCGTS---------VAMRT 72 Query: 190 KVREKRGISGNFCYDLVASFCCPCCAVAQTHQEV 291 R + GI G+ C D +A+ CCP C + Q +++ Sbjct: 73 LYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDI 106
>sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15 protein) (Onzin) Length = 112 Score = 58.5 bits (140), Expect = 1e-08 Identities = 31/93 (33%), Positives = 43/93 (46%) Frame = +1 Query: 13 AEWQHGLCGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLCGLSYCIIPPCIGALIRKK 192 + WQ LC C SDCG CL C L G A + C LCG + +R Sbjct: 21 SNWQTSLCDCFSDCGVCLCGTFCFTCL-GCQVAADMNECCLCGTT---------VAMRTL 70 Query: 193 VREKRGISGNFCYDLVASFCCPCCAVAQTHQEV 291 R + GI G+ C D + + CP C+V Q +++ Sbjct: 71 YRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDI 103
>sp|P26371|KRA59_HUMAN Keratin-associated protein 5-9 (Keratin-associated protein 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 34.3 bits (77), Expect = 0.23 Identities = 24/86 (27%), Positives = 29/86 (33%), Gaps = 7/86 (8%) Frame = +1 Query: 28 GLCGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSC----FLCGLSYCIIPPCIGALIRKKV 195 G CGC CG+ C G G SC + C C +P C + K+ Sbjct: 2 GCCGCSGGCGSSCGGCDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKRG 61 Query: 196 REKRGISGNFCYDL---VASFCCPCC 264 G S C S C PCC Sbjct: 62 CGSCGGSKGGCGSCGCSQCSCCKPCC 87
>sp|O27719|YG84_METTH Hypothetical protein MTH1684 Length = 431 Score = 31.6 bits (70), Expect = 1.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 43 CSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLCGL 144 C+DC CL + CP + + + D CF CG+ Sbjct: 345 CTDCAVCLAARRCPTHAIDNGLDL--DRCFGCGV 376
>sp|P23327|SRCH_HUMAN Sarcoplasmic reticulum histidine-rich calcium-binding protein precursor Length = 699 Score = 30.8 bits (68), Expect = 2.5 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 31 LCGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLC-GLSYCIIPPCI 171 LCG CS C C C C D E +G+ C C +C + P + Sbjct: 626 LCGYCSFCNRCTECESCHC-----DEENMGEHCDQCQHCQFCYLCPLV 668
>sp|Q92800|EZH1_HUMAN Enhancer of zeste homolog 1 (ENX-2) Length = 747 Score = 30.4 bits (67), Expect = 3.3 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +1 Query: 34 CGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLCGLSY---CIIPPCIGALIRKKVRE 201 C C + C T CPCYL ++ + D C CG S C + C I++ +++ Sbjct: 561 CRCKTQCNT----KQCPCYLAVRECDP--DLCLTCGASEHWDCKVVSCKNCSIQRGLKK 613
>sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-rich calcium-binding protein precursor Length = 852 Score = 30.4 bits (67), Expect = 3.3 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 22 QHGLCGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLC-GLSYCIIPPCI 171 Q LCG C+ C C C C D +++G+ C C +C + P + Sbjct: 776 QGSLCGYCTFCNRCTECEHCHC-----DEDSMGEHCDQCQHCQFCYLCPLV 821
>sp|Q6L8G5|KR510_HUMAN Keratin-associated protein 5-10 (Keratin-associated protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 30.4 bits (67), Expect = 3.3 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 28 GLCGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLCGLSYCIIPPC 168 G CGC CG+ C G G C CG S C +P C Sbjct: 2 GCCGCSGGCGSGCGGCGSGCGGCGSGCGGYGSGCGGCG-SSCCVPVC 47
>sp|P70351|EZH1_MOUSE Enhancer of zeste homolog 1 (ENX-2) Length = 747 Score = 30.4 bits (67), Expect = 3.3 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +1 Query: 34 CGCCSDCGTCLLSYLCPCYLVGKDAEAVGDSCFLCGLSY---CIIPPCIGALIRKKVRE 201 C C + C T CPCYL ++ + D C CG S C + C I++ +++ Sbjct: 561 CRCKTQCNT----KQCPCYLAVRECDP--DLCLTCGASEHWDCKVVSCKNCSIQRGLKK 613
>sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 precursor (Notch 3) [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2318 Score = 30.0 bits (66), Expect = 4.3 Identities = 23/76 (30%), Positives = 28/76 (36%), Gaps = 3/76 (3%) Frame = +1 Query: 43 CSDCGTC---LLSYLCPCYLVGKDAEAVGDSCFLCGLSYCIIPPCIGALIRKKVREKRGI 213 C GTC + Y+C C A GDSC + C PC Sbjct: 1094 CQHGGTCRGYMGGYVCEC-----PAGYAGDSCE-DNIDECASQPCQ-------------- 1133 Query: 214 SGNFCYDLVASFCCPC 261 +G C DLVA + C C Sbjct: 1134 NGGSCIDLVARYLCSC 1149
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 55,227,219
Number of Sequences: 369166
Number of extensions: 938142
Number of successful extensions: 2806
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2580
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2779
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4259329035
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)