DrC_00341
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00341 (315 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P68586|MTBP_BPPHT Modification methylase Phi3TI (Cytosin... 33 0.20 sp||P09389_1 [Segment 1 of 2] Modification methylase SPBeta... 33 0.20 sp|P17632|MBHL_RHOGE Uptake hydrogenase large subunit (Hydr... 28 5.0 sp|Q57532|GYRA_MYCLE DNA gyrase subunit A [Contains: Mle gy... 28 5.0 sp|P31891|MBHL_RALEU Uptake hydrogenase large subunit (Hydr... 28 6.5 sp|P53855|ATG2_YEAST Autophagy-related protein 2 (Sporulati... 28 6.5 sp|P12636|MBHL_BRAJA Uptake hydrogenase large subunit (Hydr... 28 8.5 sp|P18636|MBHL_RHILV Uptake hydrogenase large subunit (Hydr... 28 8.5 sp|P75318|Y465_MYCPN Hypothetical protein MPN465 (P01_orf199) 28 8.5
>sp|P68586|MTBP_BPPHT Modification methylase Phi3TI (Cytosine-specific methyltransferase Phi3TI) (M.Phi3TI) sp|P68585|MTBP_BACSU Phi-3T prophage-derived modification methylase Phi3TI (Cytosine-specific methyltransferase Phi3TI) (M.Phi3TI) Length = 443 Score = 33.1 bits (74), Expect = 0.20 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -3 Query: 133 CSSCSF--IIRWESYRRFVKCPMCNLLPKA 50 CS+CS +I +E Y++ VKCP C + KA Sbjct: 94 CSNCSHEHLITYEDYKKGVKCPKCEAVSKA 123
>sp||P09389_1 [Segment 1 of 2] Modification methylase SPBetaI (Cytosine-specific methyltransferase SPBetaI) (M.SPBetaI) Length = 143 Score = 33.1 bits (74), Expect = 0.20 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -3 Query: 133 CSSCSF--IIRWESYRRFVKCPMCNLLPKA 50 CS+CS +I +E Y++ VKCP C + KA Sbjct: 94 CSNCSHEHLITYEDYKKGVKCPKCEAVSKA 123
>sp|P17632|MBHL_RHOGE Uptake hydrogenase large subunit (Hydrogenlyase) (Membrane-bound hydrogenase large subunit) Length = 618 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 132 QINDHGKPSAHLHALFWVASISGL 203 Q++DH HLHAL WV +S L Sbjct: 114 QVHDHAVHFYHLHALDWVDVVSAL 137
>sp|Q57532|GYRA_MYCLE DNA gyrase subunit A [Contains: Mle gyrA intein] Length = 1273 Score = 28.5 bits (62), Expect = 5.0 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +3 Query: 33 NSLVRVAFGKRLHIGHF-TKRRYDSQRIIKEQLEQINDHGKP 155 NSLVR+ FGK + IG T +++S I L+ ++ HG P Sbjct: 135 NSLVRLLFGKSIRIGDIVTGAQFNSDNPI--DLKVLDRHGNP 174
>sp|P31891|MBHL_RALEU Uptake hydrogenase large subunit (Hydrogenlyase) (Membrane-bound hydrogenase large subunit) Length = 618 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 108 RIIKEQLEQINDHGKPSAHLHALFWVASISGL 203 R I + Q++DH HLHAL WV +S L Sbjct: 106 REIMAKTLQVHDHAVHFYHLHALDWVDVMSAL 137
>sp|P53855|ATG2_YEAST Autophagy-related protein 2 (Sporulation-specific protein 72) Length = 1592 Score = 28.1 bits (61), Expect = 6.5 Identities = 22/63 (34%), Positives = 26/63 (41%), Gaps = 13/63 (20%) Frame = -3 Query: 154 GLPWSLICSSCSFII---RWESYRRFVK----------CPMCNLLPKATRTKLFII*DYY 14 G PW L C CS I+ R +S V P LL KA LF+I DY Sbjct: 780 GFPWELKCLDCSLILHPFRLKSVMVIVLDNLTTGGSSFIPQAKLLSKA--NTLFLIDDYQ 837 Query: 13 RFR 5 F+ Sbjct: 838 NFK 840
>sp|P12636|MBHL_BRAJA Uptake hydrogenase large subunit (Hydrogenlyase) (Membrane-bound hydrogenase large subunit) Length = 596 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 99 DSQRIIKEQLEQINDHGKPSAHLHALFWVASISGL 203 +S R + + Q++DH HLHAL WV +S L Sbjct: 103 NSIRNLMQLALQVHDHVVHFYHLHALDWVDVVSAL 137
>sp|P18636|MBHL_RHILV Uptake hydrogenase large subunit (Hydrogenlyase) (Membrane-bound hydrogenase large subunit) Length = 596 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 99 DSQRIIKEQLEQINDHGKPSAHLHALFWVASISGL 203 +S R + + Q++DH HLHAL WV +S L Sbjct: 103 NSIRNLMQLALQVHDHVVHFYHLHALDWVDVVSAL 137
>sp|P75318|Y465_MYCPN Hypothetical protein MPN465 (P01_orf199) Length = 199 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 175 SACKCALGL-PWSLICSSCSFIIRWES 98 SAC+ L + PW+ ICS +F W S Sbjct: 46 SACRIDLSVFPWAFICSPWNFCSTWSS 72
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,926,252
Number of Sequences: 369166
Number of extensions: 669525
Number of successful extensions: 1612
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1601
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1612
length of database: 68,354,980
effective HSP length: 73
effective length of database: 54,869,325
effective search space used: 1700949075
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
