DrC_00151
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00151 (587 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15... 44 3e-04 sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15... 44 4e-04 sp|Q58713|YD17_METJA Putative transporter MJ1317 30 3.4 sp|P25182|VMAT_SV41 MATRIX PROTEIN 29 9.9 sp|Q10452|GSK3_SCHPO Protein kinase gsk3 (Protein kinaae skp1) 29 9.9
>sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15 protein) Length = 115 Score = 43.9 bits (102), Expect = 3e-04 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = +1 Query: 316 CVPGSNLLLRTKHRGKNNIRGTIIEDCCKTYWCYWCTICQLKRDMD 453 C+ G+++ +RT +R + I G+I +D T C CT+CQ+KRD++ Sbjct: 62 CLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDIN 107
>sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15 protein) (Onzin) Length = 112 Score = 43.5 bits (101), Expect = 4e-04 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = +1 Query: 316 CVPGSNLLLRTKHRGKNNIRGTIIEDCCKTYWCYWCTICQLKRDMD 453 C+ G+ + +RT +R + I G+I +D T +C C++CQLKRD++ Sbjct: 59 CLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104
>sp|Q58713|YD17_METJA Putative transporter MJ1317 Length = 398 Score = 30.4 bits (67), Expect = 3.4 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +2 Query: 155 KPHQSKNFQNIEIGVRDCVDAVTIALLVA*LYSLANSTYVIYIM 286 KP S N +G+++ + + +L++ +++L+N +Y+ YI+ Sbjct: 201 KPSPSNNKITFRVGIKNLPKELKLFILISAIFTLSNFSYMFYIL 244
>sp|P25182|VMAT_SV41 MATRIX PROTEIN Length = 382 Score = 28.9 bits (63), Expect = 9.9 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 274 YLYNVHNEFVFTPVCVPGSNLL--LRTKHRGKNNIRGTIIEDCCKTYWCYWCTICQLKR 444 ++Y++H E +F +C P S LL T G+ C + W + C I + K+ Sbjct: 197 FVYSIHMEIIFRLLCKPDSPLLKTYATDPEGRG---------CLASVWIHVCNILKNKK 246
>sp|Q10452|GSK3_SCHPO Protein kinase gsk3 (Protein kinaae skp1) Length = 387 Score = 28.9 bits (63), Expect = 9.9 Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 5/87 (5%) Frame = +2 Query: 122 LLEFNSKQLLFKPHQSKNFQNIEIGVRDCVDAVTIALLVA*LYSLANSTYVIYIMYTMNS 301 L+E +SK + + Q K F+N E+ + + I L+A Y+ +++ +Y+ + Sbjct: 51 LIESDSKAAIKRVLQDKRFKNRELQIMRIMKHPNIVDLIAYYYTTGDNSDEVYLNLVL-E 109 Query: 302 FLLQCVFRDQIYYLE-----PNIEAKI 367 F+ + ++R Y P +E K+ Sbjct: 110 FMPETIYRASRLYTRQKLSMPMLEVKL 136
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 62,115,560
Number of Sequences: 369166
Number of extensions: 1102430
Number of successful extensions: 2610
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 2516
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2608
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4406202450
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
