Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_023_F05 (502 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15... 44 2e-04 sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15... 44 3e-04 sp|Q58713|YD17_METJA Putative transporter MJ1317 30 2.5 sp|P25182|VMAT_SV41 MATRIX PROTEIN 29 7.1 sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 precur... 28 9.3 sp|P16200|VNB_INBMF NB glycoprotein 28 9.3
>sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein (C15 protein) Length = 115 Score = 43.9 bits (102), Expect = 2e-04 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = +1 Query: 244 CVPGSNLLLRTKHRGKNNIRGTIIEDCCKTYWCYWCTICQLKRDMD 381 C+ G+++ +RT +R + I G+I +D T C CT+CQ+KRD++ Sbjct: 62 CLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDIN 107
>sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein (C15 protein) (Onzin) Length = 112 Score = 43.5 bits (101), Expect = 3e-04 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = +1 Query: 244 CVPGSNLLLRTKHRGKNNIRGTIIEDCCKTYWCYWCTICQLKRDMD 381 C+ G+ + +RT +R + I G+I +D T +C C++CQLKRD++ Sbjct: 59 CLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104
>sp|Q58713|YD17_METJA Putative transporter MJ1317 Length = 398 Score = 30.4 bits (67), Expect = 2.5 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +2 Query: 83 KPHQSKNFQNIEIGVRDCVDAVTIALLVA*LYSLANSTYVIYIM 214 KP S N +G+++ + + +L++ +++L+N +Y+ YI+ Sbjct: 201 KPSPSNNKITFRVGIKNLPKELKLFILISAIFTLSNFSYMFYIL 244
>sp|P25182|VMAT_SV41 MATRIX PROTEIN Length = 382 Score = 28.9 bits (63), Expect = 7.1 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 202 YLYNVHNEFVFTPVCVPGSNLL--LRTKHRGKNNIRGTIIEDCCKTYWCYWCTICQLKR 372 ++Y++H E +F +C P S LL T G+ C + W + C I + K+ Sbjct: 197 FVYSIHMEIIFRLLCKPDSPLLKTYATDPEGRG---------CLASVWIHVCNILKNKK 246
>sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 precursor (QSulf1) Length = 867 Score = 28.5 bits (62), Expect = 9.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 220 NEFVFTPVCVPGSNLLLRTKHRGKNNIRGTIIEDCCKTYW 339 N FV TP+C P + +L K+ +NI T E+C W Sbjct: 79 NAFVTTPMCCPSRSSMLTGKYVHNHNIY-TNNENCSSPSW 117
>sp|P16200|VNB_INBMF NB glycoprotein Length = 99 Score = 28.5 bits (62), Expect = 9.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 378 HVTF*LTNCTPITPIRFATIFYYCSSDVIFASMFG 274 + TF TN PI+ IR + I C S ++ ++FG Sbjct: 3 NATFNYTNVNPISHIRGSVIITICVSFIVILTVFG 37
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,318,234 Number of Sequences: 369166 Number of extensions: 893496 Number of successful extensions: 2301 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2299 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 3168768640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)