Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00114 (753 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P31420|OMBP_MANSE Ommochrome-binding protein precursor (... 33 1.1 sp|P15650|ACADL_RAT Acyl-CoA dehydrogenase, long-chain spec... 30 7.0 sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 30 7.0 sp|P51174|ACADL_MOUSE Acyl-CoA dehydrogenase, long-chain sp... 30 9.1
>sp|P31420|OMBP_MANSE Ommochrome-binding protein precursor (OBP) (YCP) Length = 274 Score = 32.7 bits (73), Expect = 1.1 Identities = 19/72 (26%), Positives = 37/72 (51%) Frame = +3 Query: 477 SHSPHFNGWQGLYCHRYPSPPRKLIGVSAMRLRSILLPSDLRVHLHGLIWTHSSQKPVDQ 656 +H + G G+Y + Y + K IGV+++ + + +HGL +T S +KP Sbjct: 98 NHIVYLGGKDGIYTYDYATKSAKNIGVTSLSIWQMFY-----CPIHGLFFTTSDEKP--- 149 Query: 657 QIIKNKQIDVIL 692 + K+ Q++ I+ Sbjct: 150 YVFKDGQVNQIV 161
>sp|P15650|ACADL_RAT Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (LCAD) Length = 430 Score = 30.0 bits (66), Expect = 7.0 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 9/59 (15%) Frame = -3 Query: 661 ICWSTGFCEECVQINPCKCTRRSDGRSIDLSR---------IADTPINFLGGDGYLWQY 512 IC + F + C+Q++ T+R D S +++ +A + GG GY+W+Y Sbjct: 341 ICVTRAFVDSCLQLHE---TKRLDSASASMAKYWASELQNTVAYQCVQLHGGWGYMWEY 396
>sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 Length = 421 Score = 30.0 bits (66), Expect = 7.0 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 3/92 (3%) Frame = -3 Query: 526 YLWQYSPCQPLKCGECEQQVALCKKLGYSENTAGYLGSAKFQIDDXXXXXXXXXXXXXXX 347 ++W Y +PL + E+ A K +G+S + G L S ID Sbjct: 274 FVWDYRSSRPLH--KFEEHTAAVKAIGWSPHQRGILASGGGTIDRCLTIHNTLTGRLQNK 331 Query: 346 XXXXNVVCNQKYEGT---IIYDYEYPQNQIYL 260 + VCN + T I+ + + +NQ+ L Sbjct: 332 LDTGSQVCNMAWSKTSNEIVTTHGFAKNQVSL 363
>sp|P51174|ACADL_MOUSE Acyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (LCAD) Length = 430 Score = 29.6 bits (65), Expect = 9.1 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 9/59 (15%) Frame = -3 Query: 661 ICWSTGFCEECVQINPCKCTRRSDGRSIDLSR---------IADTPINFLGGDGYLWQY 512 IC + F + C+Q++ T+R D S +++ +A + GG GY+W+Y Sbjct: 341 ICVTRAFVDSCLQLHE---TKRLDSGSASMAKYWASELQNSVAYECVQLHGGWGYMWEY 396
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,134,803 Number of Sequences: 369166 Number of extensions: 1344045 Number of successful extensions: 3717 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3715 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 6873311200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)