Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_022_I01 (342 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P44569|5NTD_HAEIN Probable 5'-nucleotidase precursor 28 6.6 sp|Q8F8N2|TRUD_LEPIN tRNA pseudouridine synthase D (tRNA-ur... 28 6.6 sp|Q9J558|V175_FOWPV Protein FPV175 28 8.6
>sp|P44569|5NTD_HAEIN Probable 5'-nucleotidase precursor Length = 603 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 32 KYEGTIIYDYEYPQNQIYLTFLTKHACFNDHVESNIESNTES 157 KYEG Y P + ++ F+ KH F + SN++ N + Sbjct: 559 KYEGVDTY---LPDAESFIKFMKKHPHFEAYTSSNVKFNAST 597
>sp|Q8F8N2|TRUD_LEPIN tRNA pseudouridine synthase D (tRNA-uridine isomerase D) (tRNA pseudouridylate synthase D) sp|Q72N01|TRUD_LEPIC tRNA pseudouridine synthase D (tRNA-uridine isomerase D) (tRNA pseudouridylate synthase D) Length = 408 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 335 NFIKIENTNFINIFHQTQSKRFHELFRI 252 NF KI FIN + + RFH FR+ Sbjct: 141 NFEKITKNGFINYYDSQRFSRFHSEFRL 168
>sp|Q9J558|V175_FOWPV Protein FPV175 Length = 274 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 8 TINVVCNQK---YEGTIIYDYEYPQNQIYLTFLTKHACFNDHVESNIESN 148 TINVV + YE + Y+ + ++ ++ + H FND ++ I+SN Sbjct: 44 TINVVLTTRSDNYEKDVTYNDDDDHDRCIVSEIGSHHSFNDEKDNYIQSN 93
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,661,690 Number of Sequences: 369166 Number of extensions: 337339 Number of successful extensions: 806 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 68,354,980 effective HSP length: 81 effective length of database: 53,391,445 effective search space used: 1708526240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)