Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01044 (739 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Y6X0|SETBP_HUMAN SET-binding protein (SEB) 30 6.7 sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 (GLI-simila... 30 6.7
>sp|Q9Y6X0|SETBP_HUMAN SET-binding protein (SEB) Length = 1542 Score = 30.0 bits (66), Expect = 6.7 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 9 PPVPPSNKPMSLNEELGVRKNQKSNDSQPAFQSPPIIPNPK 131 PP+PP P+ G RK++ +QP QSPP P P+ Sbjct: 1482 PPLPPP-PPLPKTPRGGKRKHKPQAPAQPPQQSPPQQPLPQ 1521
>sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 (GLI-similar 1) (Gli homologous protein 1) (GliH1) Length = 789 Score = 30.0 bits (66), Expect = 6.7 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 9 PPVPPSNKPMSLNEELGVRKNQKSNDSQPAFQSPPIIPNPK 131 PP+PP+++ S + S + P+FQSPP +P+P+ Sbjct: 643 PPLPPASQSQSPGGQSF--STVPSKPTYPSFQSPPPLPSPQ 681
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,996,681 Number of Sequences: 369166 Number of extensions: 725795 Number of successful extensions: 1531 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1527 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 6631293200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)