Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01044 (739 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Y6X0|SETBP_HUMAN SET-binding protein (SEB) 30 6.7 sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 (GLI-simila... 30 6.7
>sp|Q9Y6X0|SETBP_HUMAN SET-binding protein (SEB) Length = 1542 Score = 30.0 bits (66), Expect = 6.7 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 9 PPVPPSNKPMSLNEELGVRKNQKSNDSQPAFQSPPIIPNPK 131 PP+PP P+ G RK++ +QP QSPP P P+ Sbjct: 1482 PPLPPP-PPLPKTPRGGKRKHKPQAPAQPPQQSPPQQPLPQ 1521
>sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 (GLI-similar 1) (Gli homologous protein 1) (GliH1) Length = 789 Score = 30.0 bits (66), Expect = 6.7 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 9 PPVPPSNKPMSLNEELGVRKNQKSNDSQPAFQSPPIIPNPK 131 PP+PP+++ S + S + P+FQSPP +P+P+ Sbjct: 643 PPLPPASQSQSPGGQSF--STVPSKPTYPSFQSPPPLPSPQ 681
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52,996,681
Number of Sequences: 369166
Number of extensions: 725795
Number of successful extensions: 1531
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1491
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1527
length of database: 68,354,980
effective HSP length: 108
effective length of database: 48,403,600
effective search space used: 6631293200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)