Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01022 (601 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8Y9G3|HIS5_LISMO Imidazole glycerol phosphate synthase ... 31 2.7 sp|Q5I043|UBP28_MOUSE Ubiquitin carboxyl-terminal hydrolase... 30 4.7 sp|Q96RU2|UBP28_HUMAN Ubiquitin carboxyl-terminal hydrolase... 30 4.7 sp|P03243|E1BL_ADE05 E1B protein, large T-antigen 30 6.1 sp|P03244|E1BL_ADE02 E1B protein, large T-antigen 30 6.1 sp|P47486|UVRD_MYCGE Probable DNA helicase II homolog 30 6.1 sp|Q5R4M0|GRIA2_PONPY Glutamate receptor 2 precursor (GluR-... 30 6.1 sp|P23819|GRIA2_MOUSE Glutamate receptor 2 precursor (GluR-... 30 6.1 sp|P42262|GRIA2_HUMAN Glutamate receptor 2 precursor (GluR-... 30 6.1 sp|P25355|YCU4_YEAST Hypothetical 65.2 kDa protein in THR4-... 29 7.9
>sp|Q8Y9G3|HIS5_LISMO Imidazole glycerol phosphate synthase subunit hisH (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 208 Score = 30.8 bits (68), Expect = 2.7 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 10/86 (11%) Frame = +3 Query: 78 QSSTAQPASNANDGNYDTYSHTYNYGPPTLDIDLQREYPISVVTLVNIKHCCHGNIVGAV 257 Q A P + DG Y Y H+Y P I Y I V ++N GNI GA Sbjct: 125 QIKRATPLTKQLDGEYVYYVHSYYANCPEEYIIATSGYSIEVPGMIN-----KGNIYGAQ 179 Query: 258 ----------IELLSRSDKVLYQCGS 305 +E+L +V Y C S Sbjct: 180 FHPEKSGQIGLEILKGFKEVTYSCKS 205
>sp|Q5I043|UBP28_MOUSE Ubiquitin carboxyl-terminal hydrolase 28 (Ubiquitin thiolesterase 28) (Ubiquitin-specific processing protease 28) (Deubiquitinating enzyme 28) Length = 1051 Score = 30.0 bits (66), Expect = 4.7 Identities = 33/136 (24%), Positives = 55/136 (40%), Gaps = 10/136 (7%) Frame = +3 Query: 153 GPPTLDIDLQREYPISVVTLVNIKHCCHGNIVGAVIELLSRSDKVLY-QCGSITDIRLVY 329 G P + + +YP+ V N+ C G +V I LL V Y Q T + V Sbjct: 305 GKPFCNNETFGQYPLQVNGYHNLDECLEGAMVEGDIALLPSDRSVKYGQERWFTKLPPVL 364 Query: 330 TFSCR----NEYASKIRVRHTRNDYIHIAELEVYTESDSDFLHS-----RKGKNDIHVAM 482 TF N+ + H + ++ I ++ Y + + S RK K +I V + Sbjct: 365 TFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYKSKELIRSKRESVRKLKEEIQV-L 423 Query: 483 KSKFFQVLIKGNNPRR 530 + K + + G+ P R Sbjct: 424 QQKLERYVKYGSGPSR 439
>sp|Q96RU2|UBP28_HUMAN Ubiquitin carboxyl-terminal hydrolase 28 (Ubiquitin thiolesterase 28) (Ubiquitin-specific processing protease 28) (Deubiquitinating enzyme 28) Length = 1077 Score = 30.0 bits (66), Expect = 4.7 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 10/136 (7%) Frame = +3 Query: 153 GPPTLDIDLQREYPISVVTLVNIKHCCHGNIVGAVIELLSRSDKVLY-QCGSITDIRLVY 329 G P + + +YP+ V N+ C G +V +ELL V Y Q T + V Sbjct: 304 GKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLPPVL 363 Query: 330 TFSCR----NEYASKIRVRHTRNDYIHIAELEVYTESDSDFLHS-----RKGKNDIHVAM 482 TF N+ + H + ++ I ++ Y + + + RK K +I + + Sbjct: 364 TFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIKI-L 422 Query: 483 KSKFFQVLIKGNNPRR 530 + K + + G+ P R Sbjct: 423 QQKLERYVKYGSGPAR 438
>sp|P03243|E1BL_ADE05 E1B protein, large T-antigen Length = 496 Score = 29.6 bits (65), Expect = 6.1 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 171 IDLQREYPISVVTLVNIKHCCHGNIVGAVIELLSRSDKVLYQCGSI 308 + L+ + + LVNI++CC+ + GA +E + D+V ++C I Sbjct: 178 VALRPDCKYKISKLVNIRNCCYISGNGAEVE-IDTEDRVAFRCSMI 222
>sp|P03244|E1BL_ADE02 E1B protein, large T-antigen Length = 495 Score = 29.6 bits (65), Expect = 6.1 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 171 IDLQREYPISVVTLVNIKHCCHGNIVGAVIELLSRSDKVLYQCGSI 308 + L+ + + LVNI++CC+ + GA +E + D+V ++C I Sbjct: 177 VALRPDCKYKISKLVNIRNCCYISGNGAEVE-IDTEDRVAFRCSMI 221
>sp|P47486|UVRD_MYCGE Probable DNA helicase II homolog Length = 703 Score = 29.6 bits (65), Expect = 6.1 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = -2 Query: 582 NVFICFNKSK----KQCFFNVIDEDCCLLSTLGKISTS*QHGYRFCLFLNGENQNQIRYK 415 N FI + K+K K F +++ + C LLS + ++ L ++ NQI+Y+ Sbjct: 171 NAFISYEKNKILNNKLDFHDLLIKTCNLLSNDNDLLNQWSEQFQHILVDEFQDTNQIQYE 230 Query: 414 LLIQLYVYNHFLYV 373 L+ L N L++ Sbjct: 231 LIKMLVTKNKNLFL 244
>sp|Q5R4M0|GRIA2_PONPY Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 29.6 bits (65), Expect = 6.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 3 IILISFCVTNSLQNLVLISRGKPANQSSTAQPASNANDGNYDTYSHTYN-YGPPTLDI 173 + LI FC + + R K A + P+S+ N N+ TY YN YG ++ I Sbjct: 830 VALIEFCYKSRAE----AKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI 883
>sp|P23819|GRIA2_MOUSE Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 29.6 bits (65), Expect = 6.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 3 IILISFCVTNSLQNLVLISRGKPANQSSTAQPASNANDGNYDTYSHTYN-YGPPTLDI 173 + LI FC + + R K A + P+S+ N N+ TY YN YG ++ I Sbjct: 830 VALIEFCYKSRAE----AKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI 883
>sp|P42262|GRIA2_HUMAN Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 29.6 bits (65), Expect = 6.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 3 IILISFCVTNSLQNLVLISRGKPANQSSTAQPASNANDGNYDTYSHTYN-YGPPTLDI 173 + LI FC + + R K A + P+S+ N N+ TY YN YG ++ I Sbjct: 830 VALIEFCYKSRAE----AKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI 883
>sp|P25355|YCU4_YEAST Hypothetical 65.2 kDa protein in THR4-PWP2 intergenic region Length = 563 Score = 29.3 bits (64), Expect = 7.9 Identities = 22/70 (31%), Positives = 34/70 (48%) Frame = -2 Query: 450 LNGENQNQIRYKLLIQLYVYNHFLYVSHEFLMRIHFYKKMYILILYQLCFHIDTELYLIS 271 L ENQ +I KLL+Q V FL+ + E+++ K +YI L L F+I + Sbjct: 99 LAAENQ-EIPQKLLLQNLVIRGFLHATSEYVVDTPLIKHLYIACLTCL-FNIQQNYSTVD 156 Query: 270 IVTLSLPRQY 241 + T Q+ Sbjct: 157 MTTFPALLQF 166
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,101,335 Number of Sequences: 369166 Number of extensions: 1374124 Number of successful extensions: 3470 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3468 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4602033670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)