Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01011 (1241 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q92377|MDM12_SCHPO Mitochondrial inheritance component m... 31 6.5 sp|Q37380|ATPAM_ACACA ATP synthase alpha chain, mitochondrial 31 8.5
>sp|Q92377|MDM12_SCHPO Mitochondrial inheritance component mdm12 Length = 273 Score = 31.2 bits (69), Expect = 6.5 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 132 WDFLRGPHWVKVIQNKIQCKLKKMHLPQFIDQLTVVDIHFGKEIPLI 272 W L KV+ + ++ ++ + LP +I L VVD HFGK P I Sbjct: 7 WSKLDSELEAKVL-HLLEGQVSNLSLPSYIKHLKVVDFHFGKVSPQI 52
>sp|Q37380|ATPAM_ACACA ATP synthase alpha chain, mitochondrial Length = 522 Score = 30.8 bits (68), Expect = 8.5 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 892 VGQKEISISKITELIEKKLTLEFQKVLVLPNMDDIPLPLL 1011 +GQK SISK+ L+EK +LE+ ++ + PL L Sbjct: 208 IGQKRSSISKLVTLLEKTNSLEYSIIVAATASEAAPLQYL 247
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 130,616,911
Number of Sequences: 369166
Number of extensions: 2529157
Number of successful extensions: 5929
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5703
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5926
length of database: 68,354,980
effective HSP length: 113
effective length of database: 47,479,925
effective search space used: 14243977500
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)