DrC_00952
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00952 (428 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P47530|Y288_MYCGE Hypothetical protein MG288 30 2.1 sp|Q5HKP7|ICAC_STAEQ Biofilm PIA synthesis protein icaC (In... 30 2.8 sp|Q6FMP5|PFA5_CANGA Palmitoyltransferase PFA5 (Protein fat... 29 3.6 sp|P59206|LYTB_STRR6 Putative endo-beta-N-acetylglucosamini... 28 6.2 sp|P59205|LYTB_STRPN Putative endo-beta-N-acetylglucosamini... 28 6.2 sp|P52225|CCMF_PSEFL Cytochrome c-type biogenesis protein cycK 28 6.2 sp|Q80930|VE2_HPV50 Regulatory protein E2 28 8.1
>sp|P47530|Y288_MYCGE Hypothetical protein MG288 Length = 414 Score = 30.0 bits (66), Expect = 2.1 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 11/93 (11%) Frame = +2 Query: 158 DYIRNFNIIR*KFSRKSKIEISIDYINDF----IWNNFAYFQ-----WN--LDILWFISM 304 D+ N R + K K EI I Y + +++ FA F WN +D+ + + Sbjct: 277 DWKNNGIEFRQHYPYKFKFEIDIKYQGGYKLTGLFSWFAPFSGIPSSWNGEMDVKFIVDG 336 Query: 305 DLDSLLFNCSHCSDWCCNSLFQINNQQLLFDLN 403 DLD +N +D+ SLFQ + QLLF L+ Sbjct: 337 DLD---YNLVQNTDYP-GSLFQFKDNQLLFTLH 365
>sp|Q5HKP7|ICAC_STAEQ Biofilm PIA synthesis protein icaC (Intercellular adhesion protein C) sp|P69518|ICAC_STAEP Biofilm PIA synthesis protein icaC (Intercellular adhesion protein C) Length = 355 Score = 29.6 bits (65), Expect = 2.8 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = +3 Query: 216 KFLSIILMILSGITLL---ISSGIWISYGSFPWTLTACSLTVATVLIGVVTHF 365 K+L I++M+ G +L +S + + SF +TLT + + +L+GV HF Sbjct: 214 KYLIIVIMLTLGAYVLFIAVSGSDYWNVTSFTYTLTLYNSVMFFLLLGVCMHF 266
>sp|Q6FMP5|PFA5_CANGA Palmitoyltransferase PFA5 (Protein fatty acyltransferase 5) Length = 352 Score = 29.3 bits (64), Expect = 3.6 Identities = 13/31 (41%), Positives = 23/31 (74%) Frame = +3 Query: 198 QENQKLKFLSIILMILSGITLLISSGIWISY 290 Q + +L I+L+I+SGI L++SG+++SY Sbjct: 186 QYHARLNANLIVLLIISGIGWLMTSGLFVSY 216
>sp|P59206|LYTB_STRR6 Putative endo-beta-N-acetylglucosaminidase precursor (Murein hydrolase) Length = 702 Score = 28.5 bits (62), Expect = 6.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 402 FKSNNNCWLFI*KSELQHQSEQWLQLKSK 316 + S + W +I K++ QH ++WLQ+K K Sbjct: 129 YDSQYDAWFYI-KADGQHAEKEWLQIKGK 156
>sp|P59205|LYTB_STRPN Putative endo-beta-N-acetylglucosaminidase precursor (Murein hydrolase) Length = 658 Score = 28.5 bits (62), Expect = 6.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 402 FKSNNNCWLFI*KSELQHQSEQWLQLKSK 316 + S + W +I K++ QH ++WLQ+K K Sbjct: 129 YDSQYDAWFYI-KADGQHAEKEWLQIKGK 156
>sp|P52225|CCMF_PSEFL Cytochrome c-type biogenesis protein cycK Length = 660 Score = 28.5 bits (62), Expect = 6.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 237 MILSGITLLISSGIWISYGSFPWTLTACSLTVATVLIGVVTHFF 368 ++L + L + +GI +YG F W + A L A VL+ V F Sbjct: 433 VLLGSVALAVVAGI--AYGDFNWAVLATFLLAAWVLLAGVRDIF 474
>sp|Q80930|VE2_HPV50 Regulatory protein E2 Length = 396 Score = 28.1 bits (61), Expect = 8.1 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 252 ITLLISSGIWISYGSFPWTLTACSL 326 I LL+ S +GS PWTL+ CSL Sbjct: 81 IQLLLQSLYKSDFGSEPWTLSECSL 105
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,620,972
Number of Sequences: 369166
Number of extensions: 768211
Number of successful extensions: 2006
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1969
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2006
length of database: 68,354,980
effective HSP length: 100
effective length of database: 49,881,480
effective search space used: 2095022160
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
