DrC_00927
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00927 (1272 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P23368|MAOM_HUMAN NAD-dependent malic enzyme, mitochondr... 32 3.9 sp|Q92538|GBF1_HUMAN Golgi-specific brefeldin A-resistance ... 32 5.1 sp|P37222|MAOC_LYCES NADP-dependent malic enzyme, chloropla... 31 6.7 sp|Q99KE1|MAOM_MOUSE NAD-dependent malic enzyme, mitochondr... 31 8.7
>sp|P23368|MAOM_HUMAN NAD-dependent malic enzyme, mitochondrial precursor (NAD-ME) (Malic enzyme 2) Length = 584 Score = 32.0 bits (71), Expect = 3.9 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = -2 Query: 1034 PLEKIIYVVG-----TTWFLLLCPDTIDTYPSIVLLPKVGCQCQEYDWLME*RVG*FL 876 PLEK IY++G F + D I++ IV P VG C +Y + G F+ Sbjct: 78 PLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFI 135
>sp|Q92538|GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 (BFA-resistant GEF 1) Length = 1859 Score = 31.6 bits (70), Expect = 5.1 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Frame = +2 Query: 470 SNPHQLTSLHVFIMLNLAL--VHIRQNRVADCKSMLHRITSEASAVLNQCYCLQAANFYV 643 +NPH + V I + L L V + VA C+++L I E L Q ++ N Y Sbjct: 415 TNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYA 474 Query: 644 HSFLAFCERRYQDSKSYLRAVLRM 715 S L C ++ + +L+ + M Sbjct: 475 AS-LRVCFLLFESMREHLKFQMEM 497
>sp|P37222|MAOC_LYCES NADP-dependent malic enzyme, chloroplast (NADP-ME) Length = 573 Score = 31.2 bits (69), Expect = 6.7 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -2 Query: 995 FLLLCPDTIDTYPSIVLLPKVGCQCQEYDWLME*RVG*FLYFPNK-KI*NHPVIGDW 828 F L D ++ IV P VG CQ+Y W+ + G F K KI H V+ +W Sbjct: 107 FYKLLIDNVEELLPIVYTPTVGEACQKYGWIFKRPQGLFFSLKEKGKI--HEVLKNW 161
>sp|Q99KE1|MAOM_MOUSE NAD-dependent malic enzyme, mitochondrial precursor (NAD-ME) (Malic enzyme 2) Length = 589 Score = 30.8 bits (68), Expect = 8.7 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = -2 Query: 1034 PLEKIIYVVG-----TTWFLLLCPDTIDTYPSIVLLPKVGCQCQEYDWLME*RVG*FL 876 PLEK IY++G F + D I++ IV P VG C +Y + G F+ Sbjct: 78 PLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACCQYGHIFRRPKGLFI 135
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 147,061,684
Number of Sequences: 369166
Number of extensions: 3012115
Number of successful extensions: 5864
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5623
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5864
length of database: 68,354,980
effective HSP length: 113
effective length of database: 47,479,925
effective search space used: 14718776750
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
