DrC_00888
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00888 (272 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P97675|ENPP3_RAT Ectonucleotide pyrophosphatase/phosphod... 35 0.041 sp|Q8S4P5|EZ2_MAIZE Polycomb protein EZ2 (Enhancer of zeste... 30 1.3 sp|P91758|CRNF_LYMST Cysteine-rich neurotrophic factor prec... 30 1.7 sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 pr... 30 2.3 sp|P82631|SCRC_ARATH Hypothetical protein SCRL12 precursor 28 5.1 sp|P05106|ITB3_HUMAN Integrin beta-3 precursor (Platelet me... 28 6.6 sp|P14585|LIN12_CAEEL Lin-12 protein precursor 28 6.6 sp|P82773|LC59_ARATH Putative low-molecular-weight cysteine... 28 8.6
>sp|P97675|ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase 3 (E-NPP 3) (Phosphodiesterase I/nucleotide pyrophosphatase 3) (Phosphodiesterase I beta) (PD-Ibeta) (RB13-6 antigen) (B10) [Includes: Alkaline phosphodiesterase I ; Nucleotide pyrophosphatase (NPPase)] Length = 875 Score = 35.4 bits (80), Expect = 0.041 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 13/89 (14%) Frame = +1 Query: 1 IRHEEIFCSVFVIVLMIVNCEV-------YAKETVAICRAKCWD------EGYACDKACT 141 ++ +I C+V + +L+IV+ + +E + CR KC+D EG CD CT Sbjct: 18 LKRYKILCAVLLALLVIVSLGLGLGLGLRKPEEHIGSCRKKCFDSSHRGLEGCRCDSGCT 77 Query: 142 AQKDPSSKDHMKCVHDCESGLKTCFAAKC 228 + D CV + + TC + +C Sbjct: 78 DRGDCCWDFEDTCVKSTQ--IWTCNSFRC 104
>sp|Q8S4P5|EZ2_MAIZE Polycomb protein EZ2 (Enhancer of zeste protein 2) Length = 894 Score = 30.4 bits (67), Expect = 1.3 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Frame = +1 Query: 103 CWDEGYACDKACTAQKDPSSKDHMKCVH----DCESGLKTCFAA--KCDP 234 C D+G C+K C K S K+ + H C S CFAA +CDP Sbjct: 661 CADKGTCCEKYCGCSK--SCKNKFRGCHCAKSQCRSRQCPCFAASRECDP 708
>sp|P91758|CRNF_LYMST Cysteine-rich neurotrophic factor precursor (CRNF) Length = 121 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +1 Query: 67 YAKETVAICRAKCWDEGYACDKACTAQKDPSSKDHMKCVHDCESGLKTCF 216 + ETVA C CWD G C C D + D V + TCF Sbjct: 55 FTNETVA-CMQPCWDLGIPCRTQCYKVYDQCTSDCPYTVPNPYECFTTCF 103
>sp|Q80T14|FRAS1_MOUSE Extracellular matrix protein FRAS1 precursor Length = 4010 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 175 KCVHDCESGLKTCFAAKCDPM 237 KCV C +GL CFAA+C P+ Sbjct: 178 KCV--CRNGLTQCFAAQCQPL 196
>sp|P82631|SCRC_ARATH Hypothetical protein SCRL12 precursor Length = 92 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = +1 Query: 16 IFCSVFVIVLMIVNCEVYAKETVAICRAKCWDEGYAC----DKACTAQKDPSSKDHMKCV 183 +FC + VL I EV A+ V +C+ ++ C +K C + D + +C Sbjct: 9 VFCILMFFVLNIFTVEVKAQRLVPLCKTIGYENPGKCPADGNKFCRRKLDDRYVKYKRC- 67 Query: 184 HDCE 195 DC+ Sbjct: 68 -DCQ 70
>sp|P05106|ITB3_HUMAN Integrin beta-3 precursor (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD61 antigen) Length = 788 Score = 28.1 bits (61), Expect = 6.6 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 118 YACDKACTAQKDPSSKDHMKCVHDCESGLKT--CFAAKCDP 234 + CD AC AQ +P+S H C +G T C +C P Sbjct: 457 FDCDCACQAQAEPNS-------HRCNNGNGTFECGVCRCGP 490
>sp|P14585|LIN12_CAEEL Lin-12 protein precursor Length = 1429 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +1 Query: 64 VYAKETVAICRAKCWDEGYA---CDKACTAQKDPSSKDHMKCVHDCESGLKTCFAAKCD 231 V +T CR DEG+ C++ C K + + KCV D + ++TC CD Sbjct: 40 VNGTQTSYWCRC---DEGFGGEYCEQQCDVSKCGADE---KCVFDKDYRMETCVCKDCD 92
>sp|P82773|LC59_ARATH Putative low-molecular-weight cysteine-rich protein LCR59 precursor Length = 129 Score = 27.7 bits (60), Expect = 8.6 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 11/74 (14%) Frame = +1 Query: 10 EEIFCSVFVIVLMIVNCEVYAKETVAICRAKCWDEGYA--CDKACTAQKDPSSKDH---- 171 E + VF++ L+I+ V + C GY CD+ C A+ PSS+ Sbjct: 2 ETVTSLVFIVNLLIIFTSVVNQARGDTCIDGL---GYCNNCDERCKAKHGPSSESSCDRS 58 Query: 172 -----MKCVHDCES 198 KC ++CES Sbjct: 59 VGVPLCKCYYECES 72
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28,218,702
Number of Sequences: 369166
Number of extensions: 454369
Number of successful extensions: 1338
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1300
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1338
length of database: 68,354,980
effective HSP length: 60
effective length of database: 57,270,880
effective search space used: 1718126400
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
