Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00847 (367 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P38072|SCO2_YEAST SCO2 protein, mitochondrial precursor 28 5.1
>sp|P38072|SCO2_YEAST SCO2 protein, mitochondrial precursor Length = 301 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 199 KYVCAKYNIYFHGINRTCPS-EHLVQSSFYFCI*DPFILFI 80 K VC KY +YF P+ ++LV S +F + DP FI Sbjct: 219 KSVCKKYKVYFSTPRDVKPNQDYLVDHSIFFYLIDPEGQFI 259
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,263,995 Number of Sequences: 369166 Number of extensions: 656393 Number of successful extensions: 1396 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1396 length of database: 68,354,980 effective HSP length: 88 effective length of database: 52,098,300 effective search space used: 1719243900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)