Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00830 (561 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P39911|YPHF_BACSU Hypothetical protein yphF (ORF1) 36 0.057 sp|Q74IY4|Y1326_LACJO Hypothetical UPF0085 protein LJ1326 30 4.1 sp|Q58290|Y880_METJA Hypothetical protein MJ0880 30 4.1
>sp|P39911|YPHF_BACSU Hypothetical protein yphF (ORF1) Length = 244 Score = 36.2 bits (82), Expect = 0.057 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -2 Query: 263 LILLRSKIHPNTGRSSLNSFPMQKQLVEKQHQISEFIRINRGIL--QDSLLNVSMYQ 99 ++ L ++PN +SS+++ P Q QL + Q + EF + N G+L Q ++ +YQ Sbjct: 13 VVFLSGCLYPNERKSSVHAIPYQDQLKQVQSAVDEFQKANGGLLPIQTKDMSTPLYQ 69
>sp|Q74IY4|Y1326_LACJO Hypothetical UPF0085 protein LJ1326 Length = 280 Score = 30.0 bits (66), Expect = 4.1 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +1 Query: 178 FSTNCFCIGKLFSELLPVFGCILLLNSINKTENVEINKFSNRNCYDYLIDLLAGTIVSI 354 F TN + K+FSE+ ++ I++ E + + KF+ + Y +DLL+G I +I Sbjct: 48 FITNREKLEKVFSEITEFENVLIAFTLIHEDEQLAVIKFAREHNMKY-VDLLSGVIDNI 105
>sp|Q58290|Y880_METJA Hypothetical protein MJ0880 Length = 308 Score = 30.0 bits (66), Expect = 4.1 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 2/86 (2%) Frame = -2 Query: 257 LLRSKIHPNTGRSSLNSFPMQKQLVEKQHQISEFIRINRGILQDSLLNVSMYQIRNIKPN 78 LL + I+P G+S L+ F + ++ EK+ ++ I IL +S+ V + + + Sbjct: 54 LLGNFINPTVGKSMLSGFYKENKVNEKEVIVTTIISPLPTILGESVFRVQL-PLAVVILG 112 Query: 77 YK--SLYSDIDCRDCFMLLIVGQLYA 6 YK +Y ++ F+ ++G LYA Sbjct: 113 YKLGLIYVSLNVISGFLQALIGILYA 138
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,486,421 Number of Sequences: 369166 Number of extensions: 1043369 Number of successful extensions: 2972 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2972 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 4029688280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)